Crystal Structure of the Human vaccinia-related kinase 1 bound to (R)-2-phenylaminopteridinone inhibitor. Determined by X-ray diffraction at 1.9 Å resolution. Released 6 Dec 2017.
Explore 6BP0 in 3D Show helices and sheets RCSB PDB PDBe
6BP0 contains 71 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 1 |
| β-strand | 36-42 | 7 | 1 |
| β-strand | 51-56 | 6 | 1 |
| α-helix | 61-63 | 3 | |
| β-strand | 68-74 | 7 | 1 |
| α-helix | 78-90 | 13 | |
| α-helix | 93-103 | 11 | |
| α-helix | 111-112 | 2 | |
| β-strand | 113-121 | 9 | 1 |
| β-strand | 124-132 | 9 | 1 |
| β-strand | 134-137 | 4 | 2 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 173-174 | 2 | 3 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 2 |
| β-strand | 193-195 | 3 | 2 |
| β-strand | 202-203 | 2 | 3 |
| α-helix | 206-208 | 3 | |
| α-helix | 210-212 | 3 | |
| α-helix | 230-233 | 4 | |
| α-helix | 236-238 | 3 | |
| α-helix | 240-256 | 17 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 294-296 | 3 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 4 |
| β-strand | 36-42 | 7 | 4 |
| β-strand | 51-56 | 6 | 4 |
| β-strand | 68-73 | 6 | 4 |
| α-helix | 79-90 | 12 | |
| α-helix | 93-102 | 10 | |
| α-helix | 111-112 | 2 | |
| β-strand | 113-118 | 6 | 4 |
| β-strand | 127-132 | 6 | 4 |
| β-strand | 134-137 | 4 | 5 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 173-174 | 2 | 6 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 5 |
| β-strand | 189-195 | 7 | 5 |
| β-strand | 202-203 | 2 | 6 |
| α-helix | 206-208 | 3 | |
| β-strand | 215 | 1 | 7 |
| α-helix | 217-219 | 3 | |
| α-helix | 230-233 | 4 | |
| β-strand | 236 | 1 | 7 |
| α-helix | 237-238 | 2 | |
| α-helix | 240-256 | 17 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 295-296 | 2 | |
| α-helix | 297-308 | 12 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 8 |
| β-strand | 36-42 | 7 | 8 |
| β-strand | 51-56 | 6 | 8 |
| α-helix | 61-63 | 3 | |
| β-strand | 68-74 | 7 | 8 |
| α-helix | 78-90 | 13 | |
| α-helix | 93-102 | 10 | |
| α-helix | 111-112 | 2 | |
| β-strand | 113-121 | 9 | 8 |
| β-strand | 124-132 | 9 | 8 |
| β-strand | 134-137 | 4 | 9 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 173-174 | 2 | 10 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 9 |
| β-strand | 189-195 | 7 | 9 |
| β-strand | 202-203 | 2 | 10 |
| α-helix | 206-208 | 3 | |
| α-helix | 210-212 | 3 | |
| α-helix | 230-233 | 4 | |
| α-helix | 236-238 | 3 | |
| α-helix | 240-256 | 17 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-31 | 4 | 11 |
| β-strand | 36-42 | 7 | 11 |
| β-strand | 51-56 | 6 | 11 |
| β-strand | 68-74 | 7 | 11 |
| α-helix | 78-90 | 13 | |
| α-helix | 93-102 | 10 | |
| α-helix | 111-112 | 2 | |
| β-strand | 113-121 | 9 | 11 |
| β-strand | 124-132 | 9 | 11 |
| β-strand | 134-137 | 4 | 12 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 173-174 | 2 | 13 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 12 |
| β-strand | 193-195 | 3 | 12 |
| β-strand | 202-203 | 2 | 13 |
| α-helix | 206-208 | 3 | |
| β-strand | 215 | 1 | 14 |
| α-helix | 217-219 | 3 | |
| α-helix | 230-233 | 4 | |
| β-strand | 236 | 1 | 14 |
| α-helix | 237-238 | 2 | |
| α-helix | 240-256 | 17 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 292-294 | 3 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase VRK1 | A, B, C, D | protein | 364 | Homo sapiens | Q99986 (AlphaFold model) |
>6BP0_1 Serine/threonine-protein kinase VRK1 (chains A, B, C, D) SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSE SVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHD KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA SNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSR RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIA KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAA EIEE
| ID | Name | Formula | Copies |
|---|---|---|---|
| E1D | (7R)-2-[(3,5-difluoro-4-hydroxyphenyl)amino]-5,7,8-trimethyl-7,8-dihydropteridi… | C15 H15 F2 N5 O2 | 2 |
Water and common crystallization additives (CL, EDO, SO4, GOL) are not listed.
Crystal Structure of the Human vaccinia-related kinase 1 bound to (R)-2-phenylaminopteridinone inhibitor. Counago, R.M., dos Reis, C.V., de Souza, G.P. et al. To be published.
Other PDB entries of the same protein (UniProt Q99986 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6BP0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.