6BQB: MGG4 Fab

MGG4 Fab in complex with peptide. Determined by X-ray diffraction at 1.77 Å resolution. Released 7 Mar 2018.

Method: X-ray diffraction
Resolution: 1.77 Å
Organisms: Homo sapiens, Plasmodium falciparum
Chains: 3
Atoms: 4,128
Mol. weight: 49.94 kDa
Released: 7 Mar 2018

Explore 6BQB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BQB contains 19 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	45-51	7	8
β-strand	57-59	3	8
β-strand	64	1	7
β-strand	67-72	6	7
α-helix	73-75	3
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-93	6	8
β-strand	103	1	8
β-strand	107-111	5	8
α-helix	114-116	3
β-strand	117	1	9
α-helix	118-119	2
β-strand	120-124	5	10
α-helix	125-127	3
α-helix	130-131	2
β-strand	135-145	11	10
β-strand	146	1	9
β-strand	151-154	4	11
α-helix	155-157	3
β-strand	163-165	3	10
α-helix	166-168	3
β-strand	169-170	2	10
β-strand	176-185	10	10
α-helix	186-188	3
β-strand	195-200	6	11
α-helix	201-203	3
β-strand	205-210	6	11

Chain L: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
β-strand	98	1	2
β-strand	102-106	5	2
β-strand	111	1	4
α-helix	112-113	2
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-154	2	6
α-helix	155	1
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-182	10	5
α-helix	183-188	6
β-strand	191-197	7	6
β-strand	205-210	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MGG4 Fab light chain	L	protein	220	Homo sapiens
MGG4 Fab heavy chain	H	protein	224	Homo sapiens
N-terminal junction peptide	P	protein	16	Plasmodium falciparum	Q7K740 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>6BQB_1 MGG4 Fab light chain (chains L)
DIVMTQSPDSLAVSLGERATINCRSSQSVLSSSNNKNYLAWYQHKPRQPPKLLIYWASTR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYTASPFFGGGTKVEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (H), FASTA

>6BQB_2 MGG4 Fab heavy chain (chains H)
QVQLVESGGGVVQPGRSLRLSCAASGFRFSDYGMHWVRQAPGKGLEWVALIWYDGSNESY
LDSVKGRFTISRDNSKNTLYLQMNNLRTEDTAVYYCAKLLVGITTDVFDVWGQGTVVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC

Sequence of entity 3 (P), FASTA

>6BQB_3 N-terminal junction peptide (chains P)
XKQPADGNPDPNANPX

Primary citation

A public antibody lineage that potently inhibits malaria infection through dual binding to the circumsporozoite protein. Tan, J., Sack, B.K., Oyen, D. et al. Nat Med (2018) 24:401-407. DOI 10.1038/nm.4513 · PubMed

Other PDB entries of the same protein (UniProt Q7K740 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SG5 1.4 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var2
9C79 1.46 Å, Human monoclonal antibody MAD21-101 bound to the N-terminus of cleaved circumsporozoite…
9NKZ 1.48 Å, Crystal structure of Fab MAM01 in complex with NANP6 peptide from circumsporozoite protein
9NL0 1.54 Å, Crystal structure of Fab MAM01 in complex with NPNA3 peptide from circumsporozoite protein
7SG6 1.55 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var10
6PBV 1.57 Å, Crystal structure of Fab668 complex
9NCY 1.63 Å, Fab1392 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
3VDJ 1.7 Å, Crystal structure of circumsporozoite protein aTSR domain, R32 native form
9DST 1.74 Å, Crystal structure of Fab MS-1805 in complex with N-terminal junction peptide from…
9NI1 1.75 Å, Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
7RXP 1.76 Å, Fab1512 in complex with the C-terminal alpha-TSR domain of P. falciparum
7LKB 1.8 Å, Crystal structure of PfCSP peptide 21 with vaccine-elicited human anti-malaria antibody…

Browse structure collections

About this viewer

MolViewer shows 6BQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.