6BRB: CD40 ligand

Novel non-antibody protein scaffold targeting CD40L. Determined by X-ray diffraction at 2.82 Å resolution. Released 5 Dec 2018.

Method: X-ray diffraction
Resolution: 2.82 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 2
Atoms: 1,835
Mol. weight: 25.87 kDa
Released: 5 Dec 2018

Explore 6BRB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BRB contains 6 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	123-128	6	1
β-strand	137	1	2
α-helix	138-139	2
β-strand	140-141	2	1
β-strand	147-148	2	1
β-strand	153-156	4	2
β-strand	160-163	4	2
β-strand	167-179	13	1
β-strand	189-196	8	2
β-strand	202-210	9	2
α-helix	211-213	3
β-strand	219-231	13	1
α-helix	232	1
β-strand	236-241	6	2
α-helix	244-246	3
β-strand	247	1	1
β-strand	255-260	6	1

Chain D: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	3
β-strand	12-16	5	3
β-strand	25-32	8	4
β-strand	39-45	7	4
α-helix	46-48	3
β-strand	50-53	4	3
α-helix	56-57	2
β-strand	61-70	10	4
β-strand	73-74	2	4
β-strand	78-83	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD40 ligand	A	protein	142	Homo sapiens	P29965 (AlphaFold model)
Tn3-like	D	protein	87	Escherichia coli	P24821 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6BRB_1 CD40 ligand (chains A)
PQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCS
NREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFV
NVTDPSQVSHGTGFTSFGLLKL

Sequence of entity 2 (D), FASTA

>6BRB_2 Tn3-like (chains D)
AIEVKDVTDTTALITWSDDFGEYVWCELTYGIKDVPGDRTTIDLWYHHAHYSIGNLKPDT
EYEVSLICRRGDMSSNPAKETFTTGLV

Primary citation

A CD40L-targeting protein reduces autoantibodies and improves disease activity in patients with autoimmunity. Karnell, J.L., Albulescu, M., Drabic, S. et al. Sci Transl Med (2019) 11. DOI 10.1126/scitranslmed.aar6584 · PubMed

Other PDB entries of the same protein (UniProt P29965 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W9G 1.82 Å, Crystal Structure of the Fab fragment of humanized 5c8 antibody containing the…
1ALY 2.0 Å, Crystal structure of human CD40 ligand
7SGM 2.0 Å, Crystal structure of a Fab variant containing a fluorescent noncanonical amino acid with…
3LKJ 2.5 Å, Small Molecule Inhibition of the TNF Family Cyokine CD40 Ligand Through a Subunit…
1I9R 3.1 Å, Structure of CD40L in complex with the FAB fragment of humanized 5C8 antibody
9I5N 3.4 Å, Single particle cryo electron microscopy of a Fab fragment bound to recombinant human…
3QD6 3.5 Å, Crystal structure of the CD40 and CD154 (CD40L) complex

Browse structure collections

About this viewer

MolViewer shows 6BRB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.