6BSB: Mucin-1

Crystal structure of the Mucin-1 SEA domain, L1105M mutant, Selenium-derivative. Determined by X-ray diffraction at 1.6 Å resolution. Released 5 Dec 2018.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 946
Mol. weight: 12.93 kDa
Released: 5 Dec 2018

Explore 6BSB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BSB contains 5 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	1042-1049	8	1
α-helix	1056-1059	4
α-helix	1064-1080	17
β-strand	1086-1089	4	1
β-strand	1093-1096	4	1

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	1099-1107	9	1
α-helix	1114-1123	10
α-helix	1125-1127	3
α-helix	1128-1132	5
β-strand	1136-1144	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mucin-1	A	protein	57	Homo sapiens	P15941 (AlphaFold model)
Mucin-1	B	protein	55	Homo sapiens	P15941 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6BSB_1 Mucin-1 (chains A)
SFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPG

Sequence of entity 2 (B), FASTA

>6BSB_2 Mucin-1 (chains B)
SVVVQLTMAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQS

Primary citation

High-resolution structure of intramolecularly proteolyzed human mucin-1 SEA domain. Noguera, M.E., Jakoncic, J., Ermacora, M.R. Biochim Biophys Acta Proteins Proteom (2020) 1868:140361-140361. DOI 10.1016/j.bbapap.2020.140361 · PubMed

Other PDB entries of the same protein (UniProt P15941 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BSC 1.3 Å, Crystal structure of the Mucin-1 SEA domain
7V64 1.56 Å, Crystal structure of Antibody 16A in complex with MUC1 Glycopeptide(GlycoT)
6FZQ 1.7 Å, Crystal structure of scFv-SM3 in complex with compound 3
8S6K 1.75 Å, Crystal structure of ScFv-G2D11 complexed to a bis-Tn glycopeptide
6KX1 1.77 Å, Crystal structure of SN-101 mAb in complex with MUC1 glycopeptide
6FZR 1.8 Å, Crystal structure of scFv-SM3 in complex with compound 2
8AXH 1.85 Å, Crystal structure of a MUC1-like glycopeptide containing the unnatural…
8S6T 1.85 Å, Crystal structure of Fab-3F1 complexed to a bis-STn glycopeptide
1SM3 1.95 Å, Crystal structure of the tumor specific antibody SM3 complex with its peptide epitope
8S6V 1.95 Å, Crystal structure of Fab-2D9 chimera complexed to a bis-Tn glycopeptide
5T6P 1.97 Å, Crystal structure of therapeutic mAB AR20.5 in complex with MUC1 peptide
6TGG 2.0 Å, scFv-1SM3 in complex with glycopeptide containing an sp2-imino sugar

Browse structure collections

About this viewer

MolViewer shows 6BSB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.