6BV2: Porcine aminopeptidase-N with Isoleucine

Crystal structure of porcine aminopeptidase-N with Isoleucine. Determined by X-ray diffraction at 2.14 Å resolution. Released 17 Jan 2018.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Sus scrofa
Chains: 1
Atoms: 8,281
Mol. weight: 108.72 kDa
Ligands: ZN, ILE, NAG
Released: 17 Jan 2018

Explore 6BV2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BV2 contains 48 α-helices and 37 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 48 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	66-68	3
α-helix	72-73	2
β-strand	76-87	12	1
β-strand	98-109	12	1
β-strand	113-119	7	2
β-strand	124-125	2	1
β-strand	133-136	4	1
α-helix	143-144	2
β-strand	145-151	7	2
β-strand	156-165	10	2
β-strand	170-180	11	1
β-strand	187-195	9	3
β-strand	198-206	9	3
α-helix	212-214	3
β-strand	218	1	2
β-strand	226	1	4
β-strand	227-235	9	1
β-strand	239-242	4	3
α-helix	245	1
β-strand	246	1	5
β-strand	251-252	2	1
β-strand	259-263	5	1
β-strand	264	1	5
α-helix	265-268	4
β-strand	270	1	4
α-helix	272-274	3
β-strand	277-280	4	3
β-strand	283-288	6	6
β-strand	294-299	6	6
α-helix	301-305	5
α-helix	310-326	17
β-strand	335-341	7	6
β-strand	348-349	2	6
β-strand	354-358	5	6
α-helix	359-362	4
α-helix	371-386	16
β-strand	390	1	7
β-strand	394-396	3	7
α-helix	399-401	3
α-helix	402-420	19
α-helix	426-429	4
α-helix	430	1
α-helix	431-436	6
α-helix	437-442	6
α-helix	454-456	3
α-helix	460-464	5
α-helix	469	1
α-helix	470-474	5
α-helix	475-486	12
α-helix	488-502	15
β-strand	505-507	3	7
α-helix	509-521	13
α-helix	532-540	9
β-strand	546-551	6	8
β-strand	556-561	6	8
β-strand	582-584	3	9
β-strand	586-588	3	10
β-strand	591-592	2	10
α-helix	593-595	3
β-strand	596-598	3	9
β-strand	603-605	3	8
α-helix	607-609	3
β-strand	617-619	3	10
α-helix	621-623	3
β-strand	628-631	4	8
α-helix	633-645	13
α-helix	647-649	3
α-helix	652-667	16
α-helix	673-678	6
α-helix	681-685	5
α-helix	689-706	18
α-helix	712-733	22
α-helix	744-759	16
α-helix	763-778	16
α-helix	790-800	11
α-helix	803-814	12
α-helix	819-829	11
α-helix	835-844	10
α-helix	853-855	3
α-helix	856-865	10
α-helix	869-879	11
α-helix	895-903	9
α-helix	909-919	11
α-helix	928-930	3
α-helix	931-962	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aminopeptidase N	A	protein	902	Sus scrofa	P15145 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6BV2_1 Aminopeptidase N (chains A)
QSKPWNRYRLPTTLLPDSYNVTLRPYLTPNADGLYIFKGKSIVRFLCQEPTDVIIIHSKK
LNYTTQGHMVVLRGVGDSQVPEIDRTELVELTEYLVVHLKGSLQPGHMYEMESEFQGELA
DDLAGFYRSEYMEGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPNNLTALS
NMPPKGSSTPLAEDPNWSVTEFETTPVMSTYLLAYIVSEFQSVNETAQNGVLIRIWARPN
AIAEGHGMYALNVTGPILNFFANHYNTSYPLPKSDQIALPDFNAGAMENWGLVTYRENAL
LFDPQSSSISNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGADHAEP
TWNLKDLIVPGDVYRVMAVDALASSHPLTTPAEEVNTPAQISEMFDSISYSKGASVIRML
SNFLTEDLFKEGLASYLHAFAYQNTTYLDLWEHLQKAVDAQTSIRLPDTVRAIMDRWTLQ
MGFPVITVDTKTGNISQKHFLLDSESNVTRSSAFDYLWIVPISSIKNGVMQDHYWLRDVS
QAQNDLFKTASDDWVLLNVNVTGYFQVNYDEDNWRMIQHQLQTNLSVIPVINRAQVIYDS
FNLATAHMVPVTLALDNTLFLNGEKEYMPWQAALSSLSYFSLMFDRSEVYGPMKKYLRKQ
VEPLFQHFETLTKNWTERPENLMDQYSEINAISTACSNGLPQCENLAKTLFDQWMSDPEN
NPIHPNLRSTIYCNAIAQGGQDQWDFAWGQLQQAQLVNEADKLRSALACSNEVWLLNRYL
GYTLNPDLIRKQDATSTINSIASNVIGQPLAWDFVQSNWKKLFQDYGGGSFSFSNLIQGV
TRRFSSEFELQQLEQFKKNNMDVGFGSGTRALEQALEKTKANIKWVKENKEVVLNWFIEH
SS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
ILE	Isoleucine	C6 H13 N O2	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

The Rational Design of Therapeutic Peptides for Aminopeptidase N using a Substrate-Based Approach. Joshi, S., Chen, L., Winter, M.B. et al. Sci Rep (2017) 7:1424. DOI 10.1038/s41598-017-01542-5 · PubMed

Other PDB entries of the same protein (UniProt P15145 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FKE 1.85 Å, Crystal structure of porcine aminopeptidase-N
6BV0 1.86 Å, Crystal structure of porcine aminopeptidase-N with Arginine
4HOM 1.9 Å, Crystal structure of porcine aminopeptidase-N complexed with substance P
4OU3 1.95 Å, Crystal structure of porcine aminopeptidase N complexed with CNGRCG tumor-homing peptide
4NZ8 2.0 Å, Crystal structure of porcine aminopeptidase-N complexed with cleaved poly-alanine
5LDS 2.0 Å, Structure of the porcine aminopeptidase N ectodomain
6BV1 2.0 Å, Crystal structure of porcine aminopeptidase-N with Aspartic acid
6BV4 2.02 Å, Crystal structure of porcine aminopeptidase-N with Methionine
4FKH 2.05 Å, Crystal structure of porcine aminopeptidase-N complexed with alanine
4NAQ 2.1 Å, Crystal structure of porcine aminopeptidase-N complexed with poly-alanine
6BUY 2.1 Å, Crystal structure of porcine aminopeptidase-N with Glycine
6BV3 2.2 Å, Crystal structure of porcine aminopeptidase-N with Leucine

Browse structure collections

About this viewer

MolViewer shows 6BV2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.