Crystal structure of porcine aminopeptidase-N with Leucine. Determined by X-ray diffraction at 2.2 Å resolution. Released 17 Jan 2018.
Explore 6BV3 in 3D Show helices and sheets RCSB PDB PDBe
6BV3 contains 49 α-helices and 37 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 66-68 | 3 | |
| α-helix | 72-73 | 2 | |
| β-strand | 76-87 | 12 | 1 |
| β-strand | 98-109 | 12 | 1 |
| β-strand | 113-119 | 7 | 2 |
| β-strand | 124-125 | 2 | 1 |
| β-strand | 133-136 | 4 | 1 |
| α-helix | 143-144 | 2 | |
| β-strand | 145-151 | 7 | 2 |
| β-strand | 156-165 | 10 | 2 |
| β-strand | 170-180 | 11 | 1 |
| β-strand | 187-195 | 9 | 3 |
| β-strand | 198-206 | 9 | 3 |
| α-helix | 212-214 | 3 | |
| β-strand | 218 | 1 | 2 |
| β-strand | 226 | 1 | 4 |
| β-strand | 227-235 | 9 | 1 |
| β-strand | 239-242 | 4 | 3 |
| α-helix | 245 | 1 | |
| β-strand | 246 | 1 | 5 |
| β-strand | 251-252 | 2 | 1 |
| β-strand | 259-263 | 5 | 1 |
| β-strand | 264 | 1 | 5 |
| α-helix | 265-268 | 4 | |
| β-strand | 270 | 1 | 4 |
| α-helix | 272-274 | 3 | |
| β-strand | 277-280 | 4 | 3 |
| β-strand | 283-288 | 6 | 6 |
| β-strand | 294-299 | 6 | 6 |
| α-helix | 301-306 | 6 | |
| α-helix | 310-326 | 17 | |
| β-strand | 335-341 | 7 | 6 |
| β-strand | 348-349 | 2 | 6 |
| β-strand | 354-358 | 5 | 6 |
| α-helix | 359-362 | 4 | |
| α-helix | 371-387 | 17 | |
| β-strand | 390 | 1 | 7 |
| β-strand | 394-396 | 3 | 7 |
| α-helix | 399-401 | 3 | |
| α-helix | 402-420 | 19 | |
| α-helix | 426-429 | 4 | |
| α-helix | 430 | 1 | |
| α-helix | 431-435 | 5 | |
| α-helix | 436-442 | 7 | |
| α-helix | 454-456 | 3 | |
| α-helix | 460-465 | 6 | |
| α-helix | 469 | 1 | |
| α-helix | 470-474 | 5 | |
| α-helix | 475-486 | 12 | |
| α-helix | 488-502 | 15 | |
| β-strand | 505-507 | 3 | 7 |
| α-helix | 509-521 | 13 | |
| α-helix | 532-540 | 9 | |
| β-strand | 546-551 | 6 | 8 |
| β-strand | 556-561 | 6 | 8 |
| β-strand | 582-584 | 3 | 9 |
| β-strand | 586-588 | 3 | 10 |
| β-strand | 591-592 | 2 | 10 |
| α-helix | 593-595 | 3 | |
| β-strand | 596-598 | 3 | 9 |
| β-strand | 603-605 | 3 | 8 |
| α-helix | 607-609 | 3 | |
| β-strand | 617-619 | 3 | 10 |
| α-helix | 621-623 | 3 | |
| β-strand | 628-631 | 4 | 8 |
| α-helix | 633-646 | 14 | |
| α-helix | 647-649 | 3 | |
| α-helix | 652-667 | 16 | |
| α-helix | 673-678 | 6 | |
| α-helix | 681-685 | 5 | |
| α-helix | 689-706 | 18 | |
| α-helix | 712-733 | 22 | |
| α-helix | 744-760 | 17 | |
| α-helix | 763-777 | 15 | |
| α-helix | 790-800 | 11 | |
| α-helix | 803-814 | 12 | |
| α-helix | 819-829 | 11 | |
| α-helix | 835-842 | 8 | |
| α-helix | 853-855 | 3 | |
| α-helix | 856-865 | 10 | |
| α-helix | 869-879 | 11 | |
| α-helix | 884-887 | 4 | |
| α-helix | 895-903 | 9 | |
| α-helix | 909-919 | 11 | |
| α-helix | 928-930 | 3 | |
| α-helix | 931-962 | 32 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Aminopeptidase N | A | protein | 902 | Sus scrofa | P15145 (AlphaFold model) |
>6BV3_1 Aminopeptidase N (chains A) QSKPWNRYRLPTTLLPDSYNVTLRPYLTPNADGLYIFKGKSIVRFLCQEPTDVIIIHSKK LNYTTQGHMVVLRGVGDSQVPEIDRTELVELTEYLVVHLKGSLQPGHMYEMESEFQGELA DDLAGFYRSEYMEGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPNNLTALS NMPPKGSSTPLAEDPNWSVTEFETTPVMSTYLLAYIVSEFQSVNETAQNGVLIRIWARPN AIAEGHGMYALNVTGPILNFFANHYNTSYPLPKSDQIALPDFNAGAMENWGLVTYRENAL LFDPQSSSISNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGADHAEP TWNLKDLIVPGDVYRVMAVDALASSHPLTTPAEEVNTPAQISEMFDSISYSKGASVIRML SNFLTEDLFKEGLASYLHAFAYQNTTYLDLWEHLQKAVDAQTSIRLPDTVRAIMDRWTLQ MGFPVITVDTKTGNISQKHFLLDSESNVTRSSAFDYLWIVPISSIKNGVMQDHYWLRDVS QAQNDLFKTASDDWVLLNVNVTGYFQVNYDEDNWRMIQHQLQTNLSVIPVINRAQVIYDS FNLATAHMVPVTLALDNTLFLNGEKEYMPWQAALSSLSYFSLMFDRSEVYGPMKKYLRKQ VEPLFQHFETLTKNWTERPENLMDQYSEINAISTACSNGLPQCENLAKTLFDQWMSDPEN NPIHPNLRSTIYCNAIAQGGQDQWDFAWGQLQQAQLVNEADKLRSALACSNEVWLLNRYL GYTLNPDLIRKQDATSTINSIASNVIGQPLAWDFVQSNWKKLFQDYGGGSFSFSNLIQGV TRRFSSEFELQQLEQFKKNNMDVGFGSGTRALEQALEKTKANIKWVKENKEVVLNWFIEH SS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
| LEU | Leucine | C6 H13 N O2 | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Water and common crystallization additives (SO4) are not listed.
The Rational Design of Therapeutic Peptides for Aminopeptidase N using a Substrate-Based Approach. Joshi, S., Chen, L., Winter, M.B. et al. Sci Rep (2017) 7:1424. DOI 10.1038/s41598-017-01542-5 · PubMed
Other PDB entries of the same protein (UniProt P15145 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6BV3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.