MBD2 in complex with a partially methylated DNA. Determined by X-ray diffraction at 1.84 Å resolution. Released 14 Feb 2018.
Explore 6C1T in 3D Show helices and sheets RCSB PDB PDBe
6C1T contains 4 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 150-151 | 2 | 1 |
| β-strand | 160-165 | 6 | 1 |
| β-strand | 175-180 | 6 | 1 |
| β-strand | 186-187 | 2 | 1 |
| α-helix | 190-197 | 8 | |
| α-helix | 198-200 | 3 | |
| β-strand | 206-207 | 2 | 2 |
| β-strand | 212-213 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Methyl-CpG-binding domain protein 2 | A, D | protein | 79 | Homo sapiens | Q9UBB5 (AlphaFold model) |
| 12-mer DNA | B | DNA | 12 | synthetic construct | |
| 12-mer DNA | C | DNA | 12 | synthetic construct |
>6C1T_1 Methyl-CpG-binding domain protein 2 (chains A, D) GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTV DLSSFDFRTGKMMPSKLQK
>6C1T_2 12-mer DNA (chains B) GCCTACACTCCG
>6C1T_3 12-mer DNA (chains C) CGGAGTGTAGGC
Structural basis for the ability of MBD domains to bind methyl-CG and TG sites in DNA. Liu, K., Xu, C., Lei, M. et al. J Biol Chem (2018) 293:7344-7354. DOI 10.1074/jbc.RA118.001785 · PubMed
Other PDB entries of the same protein (UniProt Q9UBB5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6C1T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.