7MWM: MBD2 with DNA

Crystal structure of MBD2 with DNA. Determined by X-ray diffraction at 1.6 Å resolution. Released 7 Jul 2021.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Homo sapiens, synthetic construct
Chains: 6
Atoms: 2,469
Mol. weight: 32.24 kDa
Released: 7 Jul 2021

Explore 7MWM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MWM contains 4 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	150-151	2	1
β-strand	160-165	6	1
β-strand	175-180	6	1
β-strand	186-187	2	1
α-helix	190-197	8
α-helix	198-200	3
β-strand	206-207	2	2
β-strand	212-213	2	2

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	150-151	2	3
β-strand	160-165	6	3
β-strand	172	1	4
β-strand	174	1	4
β-strand	175-180	6	3
β-strand	186-187	2	3
α-helix	190-197	8
α-helix	198-200	3
β-strand	206	1	5
β-strand	213	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Methyl-CpG-binding domain protein 2	A, B	protein	79	Homo sapiens	Q9UBB5 (AlphaFold model)
DNA (5'-d(gpcpcpapa)-R(P(5MC))-d(pgptptpgpgpc)-3')	C, D, E, F	DNA	12	synthetic construct

Sequence of entity 1 (A, B), FASTA

>7MWM_1 Methyl-CpG-binding domain protein 2 (chains A, B)
GATESGKRMDCPALPPGWKKEEVIKKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTV
DLSSFDFRTGKMMPSKLQK

Sequence of entity 2 (C, D, E, F), FASTA

>7MWM_2 DNA (5'-D(*GP*CP*CP*AP*A)-R(P*(5MC))-D(P*GP*TP*TP*GP*GP*C)-3') (chains C, D, E, F)
GCCAACGTTGGC

Primary citation

Crystal structure of MBD2 with DNA. Liu, K., Dong, A., Edwards, A.M. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UBB5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RAY 1.78 Å, Crystal structure of MBD2 with DNA
6C1T 1.84 Å, MBD2 in complex with a partially methylated DNA
6C1A 2.05 Å, MBD2 in complex with methylated DNA
6CNP 2.1 Å, Crystal structure of MBD2 complex with methylated CpG island
6CNQ 2.15 Å, MBD2 in complex with methylated DNA
6C1U 2.3 Å, MBD2 in complex with a deoxy-oligonucleotide
6C1V 2.3 Å, MBD2 in complex with double-stranded DNA
7MWK 2.45 Å, Crystal structure of MBD2 with DNA
6C2F 2.65 Å, MBD2 in complex with methylated DNA
7AO8 4.5 Å, Structure of the MTA1/HDAC1/MBD2 NURD deacetylase complex
7AO9 6.1 Å, Structure of the core MTA1/HDAC1/MBD2 NURD deacetylase complex
7AOA 19.4 Å, Structure of the extended MTA1/HDAC1/MBD2/RBBP4 NURD deacetylase complex

Browse structure collections

About this viewer

MolViewer shows 7MWM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.