Crystal structure of B-Myb-LIN9-LIN52 complex. Determined by X-ray diffraction at 2.32 Å resolution. Released 19 Sept 2018.
Explore 6C48 in 3D Show helices and sheets RCSB PDB PDBe
6C48 contains 16 α-helices and 4 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 350-351 | 2 | 1 |
| β-strand | 354-355 | 2 | 1 |
| α-helix | 356-391 | 36 | |
| α-helix | 394-397 | 4 | |
| α-helix | 398-428 | 31 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 64-73 | 10 | |
| α-helix | 77-106 | 30 | |
| α-helix | 112-114 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 663-667 | 5 | |
| α-helix | 672-685 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 350-351 | 2 | 2 |
| β-strand | 354-355 | 2 | 2 |
| α-helix | 356-391 | 36 | |
| α-helix | 394-397 | 4 | |
| α-helix | 398-432 | 35 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 65-73 | 9 | |
| α-helix | 77-106 | 30 | |
| α-helix | 112-114 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein lin-9 homolog | A, D | protein | 119 | Homo sapiens | Q5TKA1 (AlphaFold model) |
| Myb-related protein B | C, F | protein | 32 | Homo sapiens | P10244 (AlphaFold model) |
| Protein lin-52 homolog | B, E | protein | 68 | Homo sapiens | Q52LA3 (AlphaFold model) |
>6C48_1 Protein lin-9 homolog (chains A, D) METLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATI VLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSST
>6C48_2 Myb-related protein B (chains C, F) APMSSAWKTVACGGTRDQLFMQEKARQLLGRL
>6C48_3 Protein lin-52 homolog (chains B, E) GEFSSPPKWMAEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFL NILEKPKK
Structural mechanism of Myb-MuvB assembly. Guiley, K.Z., Iness, A.N., Saini, S. et al. Proc Natl Acad Sci U S A (2018) 115:10016-10021. DOI 10.1073/pnas.1808136115 · PubMed
Other PDB entries of the same protein (UniProt Q5TKA1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6C48 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.