7R1D: MuvB complex

Structure of MuvB complex. Determined by electron microscopy at 3.5 Å resolution. Released 10 Aug 2022.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,183
Mol. weight: 139.12 kDa
Released: 10 Aug 2022

Explore 7R1D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7R1D contains 18 α-helices and 44 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	10-26	17
α-helix	28-31	4
β-strand	32-39	8	4
β-strand	48-49	2	5
β-strand	54	1	6
β-strand	61-63	3	6
β-strand	66-69	4	5
β-strand	77-83	7	5
β-strand	85-87	3	6
β-strand	93-94	2	1
β-strand	116-123	8	5
β-strand	130-133	4	7
β-strand	136-143	8	7
β-strand	149-153	5	7
α-helix	161-162	2
β-strand	171-173	3	7
β-strand	183-185	3	8
β-strand	192-196	5	8
β-strand	202-206	5	8
β-strand	216-217	2	7
β-strand	221-223	3	8
β-strand	230-235	6	9
β-strand	242-247	6	9
β-strand	251-256	6	9
β-strand	267-270	4	9
β-strand	276-281	6	10
β-strand	288-293	6	10
β-strand	298-302	5	10
β-strand	305	1	10
β-strand	311-313	3	10
β-strand	322-325	4	11
β-strand	332-336	5	11
β-strand	342-346	5	11
α-helix	347-349	3
α-helix	357-359	3
β-strand	366-370	5	11
β-strand	377-382	6	4
β-strand	390-394	5	4
β-strand	398-404	7	4
α-helix	406-409	4

Chain B: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	96-99	4	12
β-strand	102-105	4	12
α-helix	106-108	3
α-helix	115-124	10

Chain C: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	97-113	17
α-helix	116-126	11
α-helix	133-136	4
α-helix	141-149	9
β-strand	157-158	2	1
α-helix	160-168	9
α-helix	178-198	21
β-strand	216-217	2	2
α-helix	218-221	4
β-strand	225-230	6	3
β-strand	236-246	11	3
β-strand	251-256	6	3
β-strand	263-267	5	3
α-helix	268-270	3
β-strand	271-273	3	3
α-helix	276-277	2
β-strand	279-280	2	2
α-helix	282-285	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein lin-9 homolog	C	protein	542	Homo sapiens	Q5TKA1 (AlphaFold model)
Histone-binding protein RBBP4	A	protein	425	Homo sapiens	Q09028 (AlphaFold model)
Protein lin-37 homolog	B	protein	255	Homo sapiens	Q96GY3 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>7R1D_1 Protein lin-9 homolog (chains C)
MAELDQLPDESSSAKALVSLKEGSLSNTWNEKYSSLQKTPVWKGRNTSSAVEMPFRNSKR
SRLFSDEDDRQINTRSPKRNQRVAMVPQKFTATMSTPDKKASQKIGFRLRNLLKLPKAHK
WCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAF
FEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGTKVTARLRGVHDGLFTG
QIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPSRFFMTPPR
LHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTETLGGFPVEFLIQVTRLSKILMIKKEHI
KKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQ
GLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLAEG
GDLNSFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAFAANNTN
RD

Sequence of entity 2 (A), FASTA

>7R1D_2 Histone-binding protein RBBP4 (chains A)
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS

Sequence of entity 3 (B), FASTA

>7R1D_3 Protein lin-37 homolog (chains B)
MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTPSDTHNKDCSIAA
TGKRPSARFPHQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
AWMRNSPSVRERECSPSSPLPPLPEDEEGSEVTNSKSRDVYKLPPPTPPGPPGDACRSRI
PSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILR
EMYERQGSALEVLFQ

Primary citation

Structure of a nucleosome-bound MuvB transcription factor complex reveals DNA remodelling. Koliopoulos, M.G., Muhammad, R., Roumeliotis, T.I. et al. Nat Commun (2022) 13:5075-5075. DOI 10.1038/s41467-022-32798-9 · PubMed

Other PDB entries of the same protein (UniProt Q5TKA1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6C48 2.32 Å, Crystal structure of B-Myb-LIN9-LIN52 complex
7N40 2.55 Å, Crystal structure of LIN9-RbAp48-LIN37, a MuvB subcomplex

Browse structure collections

About this viewer

MolViewer shows 7R1D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.