S25-23 Fab in complex with Chlamydiaceae LPS (Crystal form 2). Determined by X-ray diffraction at 1.75 Å resolution. Released 9 Jan 2019.
Explore 6C5K in 3D Show helices and sheets RCSB PDB PDBe
6C5K contains 31 α-helices and 89 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 7 |
| β-strand | 11-12 | 2 | 8 |
| β-strand | 18-25 | 8 | 7 |
| β-strand | 34-40 | 7 | 9 |
| β-strand | 44-51 | 8 | 9 |
| β-strand | 57-59 | 3 | 9 |
| β-strand | 67-72 | 6 | 7 |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-94 | 7 | 9 |
| β-strand | 102-103 | 2 | 9 |
| β-strand | 107-109 | 3 | 9 |
| β-strand | 110-111 | 2 | 8 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 10 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 11 |
| β-strand | 132 | 1 | 11 |
| β-strand | 135-145 | 11 | 11 |
| β-strand | 146 | 1 | 10 |
| β-strand | 151-154 | 4 | 12 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 12 |
| β-strand | 163-165 | 3 | 11 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-171 | 3 | 11 |
| β-strand | 174-184 | 11 | 11 |
| β-strand | 194-199 | 6 | 12 |
| α-helix | 200-202 | 3 | |
| β-strand | 204-209 | 6 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 18 |
| β-strand | 10-13 | 4 | 19 |
| β-strand | 19-25 | 7 | 18 |
| β-strand | 33-38 | 6 | 19 |
| β-strand | 45-49 | 5 | 19 |
| β-strand | 53-54 | 2 | 19 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 18 |
| β-strand | 70-75 | 6 | 18 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 19 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 19 |
| β-strand | 102-106 | 5 | 19 |
| β-strand | 111 | 1 | 20 |
| β-strand | 114-118 | 5 | 21 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 21 |
| β-strand | 140 | 1 | 20 |
| β-strand | 145-150 | 6 | 22 |
| β-strand | 153-155 | 3 | 22 |
| β-strand | 159-163 | 5 | 21 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 21 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-197 | 7 | 22 |
| α-helix | 204 | 1 | |
| β-strand | 205-210 | 6 | 22 |
| α-helix | 211-213 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 11-12 | 2 | 2 |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 34-40 | 7 | 3 |
| β-strand | 44-51 | 8 | 3 |
| β-strand | 57-59 | 3 | 3 |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-94 | 7 | 3 |
| β-strand | 102-103 | 2 | 3 |
| β-strand | 107-109 | 3 | 3 |
| β-strand | 110-111 | 2 | 2 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 4 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 5 |
| α-helix | 125-127 | 3 | |
| β-strand | 135-145 | 11 | 5 |
| β-strand | 146 | 1 | 4 |
| β-strand | 151-154 | 4 | 6 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 6 |
| β-strand | 163-165 | 3 | 5 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-171 | 3 | 5 |
| β-strand | 174-184 | 11 | 5 |
| β-strand | 194-199 | 6 | 6 |
| α-helix | 200-202 | 3 | |
| β-strand | 204-209 | 6 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| IgG1 Fab Heavy Chain | A, H | protein | 218 | Mus musculus | Q99LC4 (AlphaFold model) |
| IgG1 Fab Light Chain (Kappa) | B, L | protein | 219 | Mus musculus | A0A0F7R5U8 (AlphaFold model) |
>6C5K_1 IgG1 Fab Heavy Chain (chains A, H) QVQLQESGPGLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWSGGTTEYN AAFISRLSISKDNSKSQVFFKMNSLQTNDTAIYFCVRMRITTDWFAYWGQGTLVTVSAAK TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY TLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
>6C5K_2 IgG1 Fab Light Chain (Kappa) (chains B, L) DVLMTQTPLSLPVSLGDQASISCRSSQTIVHKNGNTYLEWYLQKPGQSPKLLIYKVSNRF SGVPDRFSGSGSGTDFTLKISRVEAADLGVYYCFQGSHVPYTFGGGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Subtle Changes in the Combining Site of the Chlamydiaceae-Specific mAb S25-23 Increase the Antibody-Carbohydrate Binding Affinity by an Order of Magnitude. Haji-Ghassemi, O., Muller-Loennies, S., Brooks, C.L. et al. Biochemistry (2019) 58:714-726. DOI 10.1021/acs.biochem.8b00318 · PubMed
Other PDB entries of the same protein (UniProt Q99LC4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6C5K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.