2A1W: Anti-cocaine antibody 7.5.21, crystal form I

Anti-cocaine antibody 7.5.21, crystal form I. Determined by X-ray diffraction at 2.7 Å resolution. Released 28 Jun 2005.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,935
Mol. weight: 97.02 kDa
Released: 28 Jun 2005

Explore 2A1W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A1W contains 32 α-helices and 91 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	32-39	8	2
β-strand	45-51	7	2
β-strand	58-59	2	2
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-101	10	2
β-strand	112-113	2	2
β-strand	117-119	3	2
β-strand	120-121	2	8
α-helix	125-126	2
β-strand	127	1	9
α-helix	128-129	2
β-strand	130-134	5	10
β-strand	145-155	11	10
β-strand	156	1	9
β-strand	161-164	4	11
α-helix	165-167	3
β-strand	169	1	11
β-strand	173-175	3	10
α-helix	176-178	3
β-strand	179-180	2	10
β-strand	185-194	10	10
β-strand	204-209	6	11
α-helix	210-212	3
β-strand	214-219	6	11
α-helix	222-224	3

Chain I: 10 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	17
β-strand	11-12	2	18
β-strand	18-25	8	17
α-helix	29-31	3
β-strand	34-39	6	19
β-strand	45-51	7	19
β-strand	58-59	2	19
β-strand	65	1	17
β-strand	68-73	6	17
α-helix	74-76	3
β-strand	78-83	6	17
α-helix	88-90	3
β-strand	92-99	8	19
α-helix	100	1
β-strand	110-113	4	19
β-strand	117-119	3	19
β-strand	120-121	2	18
α-helix	124-126	3
β-strand	127	1	20
α-helix	128-129	2
β-strand	130-134	5	21
β-strand	143	1	21
β-strand	145-155	11	21
β-strand	156	1	20
β-strand	161-164	4	22
α-helix	165-167	3
β-strand	173-175	3	21
α-helix	176-178	3
β-strand	179-181	3	21
β-strand	184-194	11	21
α-helix	197-200	4
β-strand	204-209	6	22
α-helix	210-212	3
β-strand	214-219	6	22

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	50-54	5	2
β-strand	58-59	2	2
β-strand	67-71	5	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	150-155	6	6
β-strand	158-160	3	6
β-strand	164-168	5	5
α-helix	169-172	4
β-strand	178-187	10	5
α-helix	188-192	5
β-strand	197-202	6	6
β-strand	210-214	5	6

Chain M: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	12
β-strand	10-13	4	13
β-strand	19-25	7	12
β-strand	38-43	6	13
β-strand	50-54	5	13
β-strand	58-59	2	13
α-helix	60	1
β-strand	67-72	6	12
β-strand	75-80	6	12
α-helix	85-87	3
β-strand	89-95	7	13
α-helix	101	1
β-strand	102-103	2	13
β-strand	107-111	5	13
β-strand	116	1	14
β-strand	119-123	5	15
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	15
β-strand	145	1	14
β-strand	150-155	6	16
β-strand	158-160	3	16
β-strand	164-168	5	15
α-helix	169-172	4
β-strand	178-187	10	15
α-helix	188-192	5
β-strand	197-202	6	16
β-strand	210-214	5	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
immunoglobulin light chain kappa	L, M	protein	216	Mus musculus	A2NHM3 (AlphaFold model)
immunoglobulin heavy chain	H, I	protein	225	Mus musculus	Q99LC4 (AlphaFold model)

Sequence of entity 1 (L, M), FASTA

>2A1W_1 immunoglobulin light chain kappa (chains L, M)
DVLMTQSPLSLPVSLGDQASISCRCSQSIVKSNGHTYLEWYLQKPGRSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQGSHIPWTFGGGTKLESKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Sequence of entity 2 (H, I), FASTA

>2A1W_2 immunoglobulin heavy chain (chains H, I)
DVKLVESGGGLVKPGGSLRLSCAASGFTFRNYGMSWVRQTPEKRLEWVAAISGNSLYTSY
PDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARHDDYYGKSPYFFDVWGAGTTVT
ASSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVL
QSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC

Primary citation

Flexibility Of Packing: Four Crystal Forms Of An Anti-Cocaine Antibody 7.5.21. Pozharski, E., Hewagama, A., Shanafelt, A. et al. To be published.

Other PDB entries of the same protein (UniProt A2NHM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PXR 1.56 Å, Anti-TAU BIIB092 FAB with TAU peptide
4TPR 1.6 Å, Structure of Tau5 antibody Fab fragment
4TQE 1.6 Å, Structure of tau peptide in complex with Tau5 antibody Fab fragment
3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2DQU 1.7 Å, Crystal form II: high resolution crystal structure of the complex of the hydrolytic…
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
1ZEA 1.78 Å, Structure of the anti-cholera toxin antibody Fab fragment TE33 in complex with a D-peptide
1PZ5 1.8 Å, Structural basis of peptide-carbohydrate mimicry in an antibody combining site
2DQT 1.8 Å, High resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and…

Browse structure collections

About this viewer

MolViewer shows 2A1W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.