Human CtBP1 (28-378). Determined by X-ray diffraction at 2.6 Å resolution. Released 9 May 2018.
Explore 6CDF in 3D Show helices and sheets RCSB PDB PDBe
6CDF contains 20 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-28 | 3 | |
| β-strand | 29-32 | 4 | 1 |
| α-helix | 42-45 | 4 | |
| β-strand | 50-53 | 4 | 1 |
| α-helix | 59-61 | 3 | |
| α-helix | 64-69 | 6 | |
| β-strand | 72-75 | 4 | 1 |
| β-strand | 81 | 1 | 2 |
| α-helix | 83-87 | 5 | |
| β-strand | 94-97 | 4 | 1 |
| β-strand | 105 | 1 | 2 |
| α-helix | 107-112 | 6 | |
| β-strand | 116-118 | 3 | 1 |
| α-helix | 125-141 | 17 | |
| α-helix | 143-151 | 9 | |
| α-helix | 159-165 | 7 | |
| β-strand | 176-180 | 5 | 3 |
| α-helix | 184-195 | 12 | |
| α-helix | 198 | 1 | |
| β-strand | 199-203 | 5 | 3 |
| α-helix | 208 | 1 | |
| α-helix | 211-214 | 4 | |
| β-strand | 218-219 | 2 | 3 |
| α-helix | 223-229 | 7 | |
| β-strand | 232-235 | 4 | 3 |
| β-strand | 247 | 1 | 4 |
| α-helix | 249-252 | 4 | |
| α-helix | 256 | 1 | |
| β-strand | 259-263 | 5 | 3 |
| α-helix | 267-269 | 3 | |
| β-strand | 270 | 1 | 4 |
| α-helix | 272-281 | 10 | |
| β-strand | 284-289 | 6 | 3 |
| β-strand | 310-312 | 3 | 3 |
| α-helix | 321-340 | 20 | |
| β-strand | 350 | 1 | 1 |
| α-helix | 353-355 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| C-terminal-binding protein 1 | A | protein | 373 | Homo sapiens | Q13363 (AlphaFold model) |
>6CDF_1 C-terminal-binding protein 1 (chains A) MGSSHHHHHHSSGLVPRGSHMPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKV LNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVE ETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVG QAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHL INDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKD APNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATHWASMD PAVVHPELNGAAY
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
| NAI | 1,4-dihydronicotinamide adenine dinucleotide | C21 H29 N7 O14 P2 | 1 |
Water and common crystallization additives (FMT) are not listed.
Assembly of human C-terminal binding protein (CtBP) into tetramers. Bellesis, A.G., Jecrois, A.M., Hayes, J.A. et al. J Biol Chem (2018) 293:9101-9112. DOI 10.1074/jbc.RA118.002514 · PubMed
Other PDB entries of the same protein (UniProt Q13363 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6CDF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.