6CMX: Human Teneurin 2 extra-cellular region

Human Teneurin 2 extra-cellular region. Determined by electron microscopy at 3.1 Å resolution. Released 25 Jul 2018.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 10,139
Mol. weight: 227.47 kDa
Ligands: MAN, NAG
Released: 25 Jul 2018

Explore 6CMX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CMX contains 22 α-helices and 130 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 130 β-strands

Element	Residues	Length	Sheet
β-strand	911-914	4	1
α-helix	915-917	3
β-strand	930-931	2	2
β-strand	936-937	2	2
β-strand	938-942	5	3
β-strand	949-953	5	3
α-helix	954-956	3
β-strand	962	1	4
β-strand	964-969	6	1
β-strand	980-981	2	5
β-strand	984-985	2	6
β-strand	994-995	2	5
β-strand	1001-1004	4	1
β-strand	1007	1	4
β-strand	1010	1	7
β-strand	1016	1	7
β-strand	1020-1027	8	6
β-strand	1028	1	5
β-strand	1041-1048	8	6
α-helix	1051-1053	3
β-strand	1062	1	3
β-strand	1067-1068	2	8
β-strand	1075-1076	2	8
β-strand	1082-1083	2	8
β-strand	1457-1461	5	9
β-strand	1466-1470	5	9
β-strand	1476-1481	6	9
β-strand	1487-1493	7	9
β-strand	1499-1504	6	9
β-strand	1507-1511	5	9
β-strand	1514	1	10
β-strand	1520	1	10
β-strand	1522-1524	3	9
β-strand	1530-1534	5	9
β-strand	1543-1545	3	9
β-strand	1550-1553	4	9
β-strand	1555-1556	2	11
β-strand	1563-1564	2	11
β-strand	1587	1	12
β-strand	1595	1	12
β-strand	1599	1	13
β-strand	1607-1608	2	13
β-strand	1611	1	12
β-strand	1619-1624	6	13
β-strand	1628-1634	7	13
β-strand	1644-1645	2	13
β-strand	1652-1653	2	14
β-strand	1659-1662	4	14
β-strand	1677-1683	7	14
β-strand	1692-1702	11	14
β-strand	1705-1715	11	14
β-strand	1718-1726	9	14
β-strand	1731	1	14
β-strand	1734-1736	3	14
β-strand	1742-1744	3	14
β-strand	1746	1	14
β-strand	1747	1	15
β-strand	1753	1	15
β-strand	1757-1758	2	14
β-strand	1765-1766	2	16
β-strand	1777-1780	4	16
β-strand	1783-1789	7	16
β-strand	1795-1800	6	16
β-strand	1805	1	16
β-strand	1807-1809	3	17
β-strand	1816-1818	3	17
β-strand	1824-1829	6	17
β-strand	1835-1839	5	17
β-strand	1845	1	17
β-strand	1848-1853	6	18
β-strand	1856-1861	6	18
β-strand	1870-1874	5	18
β-strand	1880-1885	6	18
β-strand	1890-1896	7	18
β-strand	1902-1907	6	18
β-strand	1910-1916	7	18
β-strand	1923-1930	8	18
β-strand	1936-1941	6	18
β-strand	1946-1950	5	18
β-strand	1961-1964	4	18
β-strand	1965-1967	3	19
β-strand	1974-1977	4	19
β-strand	1980-1981	2	18
β-strand	1984-1985	2	18
α-helix	1986-1988	3
β-strand	1992-1993	2	20
β-strand	2000-2001	2	20
β-strand	2003	1	21
β-strand	2006	1	21
β-strand	2007-2011	5	22
β-strand	2014-2018	5	22
β-strand	2023-2028	6	22
β-strand	2034-2038	5	22
β-strand	2048-2054	7	22
β-strand	2057-2065	9	22
β-strand	2073-2079	7	22
β-strand	2085-2090	6	22
β-strand	2094-2097	4	22
β-strand	2099	1	23
β-strand	2108-2109	2	23
β-strand	2118-2119	2	23
β-strand	2130-2131	2	24
β-strand	2134-2135	2	24
β-strand	2147	1	25
β-strand	2150-2151	2	25
β-strand	2154	1	26
β-strand	2160	1	26
β-strand	2163-2165	3	25
β-strand	2171-2176	6	25
β-strand	2182-2187	6	25
β-strand	2192-2194	3	25
β-strand	2196	1	27
β-strand	2208	1	27
β-strand	2211	1	25
β-strand	2216	1	25
β-strand	2219-2222	4	28
β-strand	2228-2232	5	28
β-strand	2239	1	28
β-strand	2240-2243	4	29
β-strand	2249-2253	5	29
β-strand	2259-2261	3	29
β-strand	2264-2266	3	30
β-strand	2269-2273	5	30
β-strand	2289-2290	2	31
β-strand	2297-2299	3	31
β-strand	2302-2303	2	31
α-helix	2319-2322	4
α-helix	2335-2337	3
α-helix	2342-2344	3
α-helix	2346-2348	3
α-helix	2353-2359	7
α-helix	2371-2374	4
α-helix	2380-2382	3
α-helix	2383-2389	7
α-helix	2394-2395	2
α-helix	2399-2408	10
α-helix	2409-2413	5
α-helix	2436	1
β-strand	2437	1	18
α-helix	2438	1
β-strand	2449-2450	2	32
β-strand	2454-2456	3	32
α-helix	2465-2474	10
β-strand	2477-2478	2	32
α-helix	2479-2480	2
β-strand	2485-2487	3	33
β-strand	2490-2492	3	33
α-helix	2560-2590	31
α-helix	2598-2600	3
α-helix	2604-2609	6
β-strand	2618-2620	3	34
β-strand	2637-2639	3	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Teneurin-2	A	protein	1999	Homo sapiens	Q9NT68 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6CMX_1 Teneurin-2 (chains A)
HHHHHHHHASDTYKLVIVLNGTTFTYTTEAVDAATAEKVFKQYANDAGVDGEWTYDAATK
TFTVTEASENLYFQSGSTSCADNKDNEGDGLVDCLDPDCCLQSACQNSLLCRGSRDPLDI
IQQGQTDWPAVKSFYDRIKLLAGKDSTHIIPGENPFNSSLVSLIRGQVVTTDGTPLVGVN
VSFVKYPKYGYTITRQDGTFDLIANGGASLTLHFERAPFMSQERTVWLPWNSFYAMDTLV
MKTEENSIPSCDLSGFVRPDPIIISSPLSTFFSAAPGQNPIVPETQVLHEEIELPGSNVK
LRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDK
TDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHILN
VKSGILHKGTGENQFLTQQPAIITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGID
GSLYVGDFNYIRRIFPSRNVTSILELRNNPAHKYYLAVDPVSGSLYVSDTNSRRIYRVKS
LSGTKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAIDATLMSPRGIAVDKNGLMYFVDAT
MIRKVDQNGIISTLLGSNDLTAVRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLENN
VILRITENHQVSIIAGRPMHCQVPGIDYSLSKLAIHSALESASAIAISHTGVLYITETDE
KKINRLRQVTTNGEICLLAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDG
TIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLY
NFTYSTDNDVTELIDNNGNSLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNL
ELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDI
ENSNRDDDVTVITNLSSVEASYTVVQDQVRNSYQLCNNGTLRVMYANGMGISFHSEPHVL
AGTITPTIGRCNISLPMENGLNSIEWRLRKEQIKGKVTIFGRKLRVHGRNLLSIDYDRSI
RTEKIYDDHRKFTLRIIYDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDI
DKQGRIVSRMFADGKVWSYSYLDKSMVLLLQSQRQYIFEYDSSDRLLAVTMPSVARHSMS
THTSIGYIRNIYNPPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDS
TAVTFGYDETTGVLKMVNLQSGGFSCTIRYRKIGPLVDKQIYRFSEEGMVNARFDYTYHD
NSFRIASIKPVISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFD
THGRIKEVQYEMFRSLMYWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQLQSVA
VNDRPTWRYSYDLNGNLHLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGS
DIFEYNSKGLLTRAYNKASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNPTRITHV
YNHSNSEITSLYYDLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYG
EIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWKNVGKEPAPF
NLYMFKSNNPLSSELGLKNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQ
ASENGQLITGVQQKTERHNQAFMALEGQVITKKLHASIREKAGHWFATTTPIIGKGIMFA
IKEGRVTTGVSSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGSADGDLVTLG
TTIGRKVLESGVNVTVSQPTLLVNGRTRRFTNIEFQYSTLLLSIRYGLTPDTLDEEKARV
LDQARQRALGTAWAKEQQKARDGREGSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQYPE
LADSSSNIQFLRQNEMGKR

Ligands and cofactors

ID	Name	Formula	Copies
MAN	alpha-D-mannopyranose	C6 H12 O6	3
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	9

Primary citation

Structural Basis for Teneurin Function in Circuit-Wiring: A Toxin Motif at the Synapse. Li, J., Shalev-Benami, M., Sando, R. et al. Cell (2018) 173:735-748.e15. DOI 10.1016/j.cell.2018.03.036 · PubMed

Other PDB entries of the same protein (UniProt Q9NT68 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VHH 2.97 Å, Human Teneurin-2 and human Latrophilin-3 binary complex

Browse structure collections

About this viewer

MolViewer shows 6CMX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.