6VHH: Teneurin-2

Human Teneurin-2 and human Latrophilin-3 binary complex. Determined by electron microscopy at 2.97 Å resolution. Released 3 Jun 2020.

Method: Electron microscopy
Resolution: 2.97 Å
Organism: Homo sapiens
Chains: 2
Atoms: 14,219
Mol. weight: 314.57 kDa
Ligands: NAG
Released: 3 Jun 2020

Explore 6VHH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6VHH contains 35 α-helices and 170 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 160 β-strands

Element	Residues	Length	Sheet
α-helix	906-908	3
β-strand	911-914	4	1
α-helix	915-917	3
β-strand	930-931	2	2
β-strand	936-937	2	2
β-strand	938-942	5	3
α-helix	943	1
β-strand	949-953	5	3
β-strand	962	1	4
β-strand	964-967	4	1
β-strand	977-986	10	5
β-strand	991-996	6	5
β-strand	1002-1004	3	1
α-helix	1005-1006	2
β-strand	1007	1	4
β-strand	1010	1	6
β-strand	1016	1	6
β-strand	1019-1031	13	5
β-strand	1039-1050	12	5
β-strand	1061-1062	2	3
β-strand	1067-1069	3	7
β-strand	1074-1076	3	7
β-strand	1082-1084	3	7
α-helix	1085-1087	3
α-helix	1089-1090	2
β-strand	1091-1096	6	8
β-strand	1111-1112	2	9
β-strand	1123-1126	4	9
β-strand	1132-1135	4	9
β-strand	1139-1143	5	9
β-strand	1148-1154	7	9
β-strand	1163-1167	5	10
β-strand	1174-1178	5	10
β-strand	1183-1186	4	10
β-strand	1187	1	11
β-strand	1200	1	11
β-strand	1204	1	10
α-helix	1209-1211	3
α-helix	1217-1219	3
β-strand	1223	1	12
β-strand	1233-1237	5	13
β-strand	1243-1246	4	13
β-strand	1251-1254	4	13
β-strand	1259	1	12
β-strand	1260	1	13
β-strand	1264	1	13
β-strand	1294-1295	2	14
β-strand	1303-1306	4	14
β-strand	1310-1314	5	14
β-strand	1320-1325	6	14
β-strand	1342	1	15
β-strand	1351-1356	6	16
β-strand	1362-1367	6	16
β-strand	1373-1378	6	16
β-strand	1383	1	15
β-strand	1384-1388	5	16
β-strand	1406	1	17
β-strand	1411	1	8
α-helix	1412-1414	3
β-strand	1416	1	17
β-strand	1420-1425	6	8
β-strand	1431-1435	5	8
β-strand	1441-1445	5	8
β-strand	1457-1461	5	18
β-strand	1466-1470	5	18
β-strand	1476-1481	6	18
β-strand	1487-1493	7	18
β-strand	1499-1503	5	18
β-strand	1509-1514	6	18
β-strand	1520-1524	5	18
β-strand	1530-1535	6	18
β-strand	1541-1545	5	18
β-strand	1550-1553	4	18
β-strand	1554-1557	4	19
β-strand	1560-1566	7	19
β-strand	1574-1578	5	19
β-strand	1584-1588	5	19
β-strand	1594-1601	8	19
β-strand	1605-1611	7	19
β-strand	1617-1624	8	19
β-strand	1628-1635	8	19
β-strand	1638-1645	8	19
β-strand	1650-1653	4	19
β-strand	1659-1667	9	19
β-strand	1671-1683	13	19
β-strand	1690-1702	13	19
β-strand	1705-1715	11	19
β-strand	1718-1726	9	19
β-strand	1731-1736	6	19
β-strand	1742-1747	6	19
β-strand	1753-1757	5	19
α-helix	1762-1764	3
β-strand	1765-1769	5	19
β-strand	1775-1780	6	19
β-strand	1783-1789	7	19
β-strand	1795-1800	6	19
β-strand	1805-1809	5	19
β-strand	1816-1818	3	19
β-strand	1824-1829	6	19
β-strand	1835-1839	5	19
β-strand	1845-1853	9	19
β-strand	1856-1862	7	19
β-strand	1870-1874	5	19
β-strand	1880-1885	6	19
β-strand	1890-1896	7	19
β-strand	1902-1907	6	19
β-strand	1910-1916	7	19
β-strand	1923-1930	8	19
β-strand	1933-1942	10	19
β-strand	1945-1953	9	19
β-strand	1961-1967	7	19
β-strand	1974-1981	8	19
β-strand	1984-1985	2	19
α-helix	1986-1988	3
β-strand	1989-1990	2	19
β-strand	1991-1993	3	20
β-strand	2000-2003	4	20
β-strand	2006-2011	6	20
β-strand	2014-2018	5	20
β-strand	2022-2028	7	20
β-strand	2034-2041	8	20
β-strand	2044-2053	10	20
β-strand	2059-2066	8	20
β-strand	2073-2079	7	20
β-strand	2085-2090	6	20
β-strand	2093-2097	5	20
β-strand	2099-2100	2	21
β-strand	2106-2109	4	21
β-strand	2118-2119	2	21
β-strand	2120-2122	3	22
β-strand	2128-2131	4	22
β-strand	2134-2135	2	22
β-strand	2136-2138	3	23
β-strand	2144-2147	4	23
β-strand	2150-2154	5	23
β-strand	2160-2165	6	23
β-strand	2170-2176	7	23
β-strand	2182-2187	6	23
β-strand	2192-2196	5	23
β-strand	2208-2211	4	23
β-strand	2216-2222	7	23
β-strand	2228-2233	6	23
β-strand	2238-2243	6	23
β-strand	2249-2254	6	23
β-strand	2259-2262	4	23
β-strand	2263-2265	3	24
β-strand	2271-2274	4	24
β-strand	2283	1	25
α-helix	2285-2287	3
β-strand	2289-2291	3	25
β-strand	2296-2299	4	25
β-strand	2302-2305	4	25
β-strand	2310-2311	2	25
α-helix	2316-2321	6
β-strand	2333	1	25
α-helix	2335-2337	3
α-helix	2346-2348	3
α-helix	2354-2359	6
α-helix	2364-2366	3
α-helix	2371-2375	5
α-helix	2380-2382	3
α-helix	2383-2389	7
α-helix	2394-2395	2
α-helix	2399-2408	10
α-helix	2409-2413	5
β-strand	2435	1	19
β-strand	2437	1	19
β-strand	2446-2450	5	26
β-strand	2454	1	27
β-strand	2455-2459	5	26
α-helix	2465-2474	10
β-strand	2478-2479	2	27
β-strand	2485-2487	3	27
β-strand	2490-2497	8	27
α-helix	2501-2508	8
β-strand	2513-2516	4	27
β-strand	2522-2526	5	27
β-strand	2529-2532	4	28
β-strand	2535-2538	4	28
β-strand	2540-2546	7	27
β-strand	2549-2555	7	27
α-helix	2559-2561	3
α-helix	2563-2591	29
β-strand	2595	1	29
β-strand	2597	1	29
α-helix	2599-2600	2
α-helix	2603-2609	7
β-strand	2616-2620	5	30
α-helix	2628-2630	3
α-helix	2634-2636	3
β-strand	2637-2641	5	30

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	30	1
β-strand	31-32	2	31
β-strand	35-36	2	31
α-helix	40	1
β-strand	41-44	4	32
β-strand	50-51	2	33
β-strand	55-59	5	31
β-strand	60	1	34
α-helix	70-73	4
β-strand	78	1	34
α-helix	83-90	8
β-strand	96-99	4	32
β-strand	116-121	6	31
β-strand	123-124	2	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Teneurin-2	A	protein	1928	Homo sapiens	Q9NT68 (AlphaFold model)
Adhesion G protein-coupled receptor L3	B	protein	852	Homo sapiens	Q9HAR2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6VHH_1 Teneurin-2 (chains A)
TSCADNKDNEGDGLVDCLDPDCCLQSACQNSLLCRGSRDPLDIIQQGQTDWPAVKSFYDR
IKLLAGKDSTHIIPGENPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQD
GTFDLIANGGASLTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCDLSGFV
RPDPIIISSPLSTFFSAAPGQNPIVPETQVLHEEIELPGSNVKLRYLSSRTAGYKSLLKI
TMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVS
VGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHILNVKSGILHKGTGENQFLT
QQPAIITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGIDGSLYVGDFNYIRRIFPS
RNVTSILELRNNPAHKYYLAVDPVSGSLYVSDTNSRRIYRVKSLSGTKDLAGNSEVVAGT
GEQCLPFDEARCGDGGKAIDATLMSPRGIAVDKNGLMYFVDATMIRKVDQNGIISTLLGS
NDLTAVRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVSIIAGR
PMHCQVPGIDYSLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICL
LAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSK
NKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSTDNDVTELIDNN
GNSLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGLLATK
SDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVITNLSS
VEASYTVVQDQVRNSYQLCNNGTLRVMYANGMGISFHSEPHVLAGTITPTIGRCNISLPM
ENGLNSIEWRLRKEQIKGKVTIFGRKLRVHGRNLLSIDYDRSIRTEKIYDDHRKFTLRII
YDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFADGKVW
SYSYLDKSMVLLLQSQRQYIFEYDSSDRLLAVTMPSVARHSMSTHTSIGYIRNIYNPPES
NASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVLKMV
NLQSGGFSCTIRYRKIGPLVDKQIYRFSEEGMVNARFDYTYHDNSFRIASIKPVISETPL
PVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMFRSLM
YWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNL
HLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGSDIFEYNSKGLLTRAYNK
ASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYDLQG
HLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFH
GGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWKNVGKEPAPFNLYMFKSNNPLSSELGL
KNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASENGQLITGVQQKTER
HNQAFMALEGQVITKKLHASIREKAGHWFATTTPIIGKGIMFAIKEGRVTTGVSSIASED
SRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGSADGDLVTLGTTIGRKVLESGVNVTVS
QPTLLVNGRTRRFTNIEFQYSTLLLSIRYGLTPDTLDEEKARVLDQARQRALGTAWAKEQ
QKARDGREGSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQNEMG
KRHHHHHH

Sequence of entity 2 (B), FASTA

>6VHH_2 Adhesion G protein-coupled receptor L3 (chains B)
SRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDPAQMENIRCYL
PDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVEQKVFLCPGLLK
GVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTY
KLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGK
SDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGIL
YVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNPRDNLLYVWN
NYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELERPSVKDISTTGPLGMGSTTT
STTLRTTTLSPGRSTTPSVSGRRNRSTSTPSPAVEVLDDMTTHLPSASSQIPALEESCEA
VEAREIMWFKTRQGQIAKQPCPAGTIGVSTYLCLAPDGIWDPQGPDLSNCSSPWVNHITQ
KLKSGETAANIARELAEQTRNHLNAGDITYSVRAMDQLVGLLDVQLRNLTPGGKDSAARS
LNKAMVETVNNLLQPQALNAWRDLTTSDQLRAATMLLHTVEESAFVLADNLLKTDIVREN
TDNIKLEVARLSTEGNLEDLKFPENMGHGSTIQLSANTLKQNGRNGEIRVAFVLYNNLGP
YLSTENASMKLGTEALSTNHSVIVNSPVITAAINKEFSNKVYLADPVVFTVKHIKQSEEN
FNPNCSFWSYSKRTMTGYWSTQGCRLLTTNKTHTTCSCNHLTNFAVLMAHVEVKHSDAVH
DLLLDVHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Alternative splicing controls teneurin-latrophilin interaction and synapse specificity by a shape-shifting mechanism. Li, J., Xie, Y., Cornelius, S. et al. Nat Commun (2020) 11:2140-2140. DOI 10.1038/s41467-020-16029-7 · PubMed

Other PDB entries of the same protein (UniProt Q9NT68 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CMX 3.1 Å, Human Teneurin 2 extra-cellular region

Browse structure collections

About this viewer

MolViewer shows 6VHH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.