6CO4: Proteasomal ubiquitin receptor ADRM1

Structure of the Rpn13-Rpn2 complex provides insights for Rpn13 and Uch37 as anticancer targets. Determined by solution NMR. Released 4 Apr 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,054
Mol. weight: 19.04 kDa
Released: 4 Apr 2018

Explore 6CO4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CO4 contains 2 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	21-30	10	1
β-strand	31-34	4	2
β-strand	37-40	4	2
β-strand	45-51	7	1
β-strand	57-63	7	1
β-strand	69-74	6	1
β-strand	80-84	5	1
β-strand	93-98	6	1
β-strand	104-109	6	1
α-helix	117-129	13

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	941-947	7
β-strand	948-949	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proteasomal ubiquitin receptor ADRM1	A	protein	154	Homo sapiens	Q16186 (AlphaFold model)
26S proteasome non-ATPase regulatory subunit 1	B	protein	18	Homo sapiens	Q99460 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6CO4_1 Proteasomal ubiquitin receptor ADRM1 (chains A)
GPGSMTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSL
IHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQ
DEEHCRKVNEYLNNPPMPGALGASGSSGHELSAL

Sequence of entity 2 (B), FASTA

>6CO4_2 26S proteasome non-ATPase regulatory subunit 1 (chains B)
GPGSQEPEPPEPFEYIDD

Primary citation

Structure of the Rpn13-Rpn2 complex provides insights for Rpn13 and Uch37 as anticancer targets. Lu, X., Nowicka, U., Sridharan, V. et al. Nat Commun (2017) 8:15540. DOI 10.1038/ncomms15540 · PubMed

Other PDB entries of the same protein (UniProt Q16186 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V1Y 1.42 Å, Crystal structure of the ternary RPN13 PRU-RPN2 (940-953)-ubiquitin complex
6OI4 1.76 Å, RPN13 (19-132)-RPN2 (940-952) pY950-Ub complex
5IRS 1.8 Å, crystal structure of the proteasomal Rpn13 PRU-domain
8VWO 1.85 Å, Crystal structure of hRpn13 Pru bound with U-shaped peptide
4WLR 2.0 Å, Crystal Structure of mUCH37-hRPN13 CTD-hUb complex
5V1Z 2.0 Å, Crystal structure of the RPN13 PRU-RPN2 (932-953)-ubiquitin complex
8FTQ 2.1 Å, Crystal structure of hRpn13 Pru domain in complex with Ubiquitin and XL44
4UEL 2.3 Å, UCH-L5 in complex with ubiquitin-propargyl bound to the RPN13 DEUBAD domain
9E7K 2.41 Å, Crystal structure of the UCH37 RPN13 DEUBAD complex bound to an inhibitory nanobody in…
4UEM 2.82 Å, UCH-L5 in complex with the RPN13 DEUBAD domain
4WLQ 2.85 Å, Crystal structure of mUCH37-hRPN13 CTD complex
2KQZ Solution structure of the Rpn13 DEUBAD domain

Browse structure collections

About this viewer

MolViewer shows 6CO4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.