6CTE: Immunoglobulin G-binding protein G
77Se-NMR probes the protein environment of selenomethionine. Determined by X-ray diffraction at 1.2 Å resolution. Released 10 Jul 2019.
- Method
- X-ray diffraction
- Resolution
- 1.2 Å
- Organism
- Streptococcus sp. group G
- Chains
- 2
- Atoms
- 1,090
- Mol. weight
- 13.63 kDa
- Ligands
- PO4, MRD
- Released
- 10 Jul 2019
Explore 6CTE in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6CTE contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and B: 1 helix, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 13-19 | 7 | 1 |
| α-helix | 23-36 | 14 | |
| β-strand | 42-46 | 5 | 1 |
| β-strand | 51-55 | 5 | 1 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Immunoglobulin G-binding protein G | A, B | protein | 56 | Streptococcus sp. group G | P19909 (AlphaFold model) |
Sequence of entity 1 (A, B), FASTA
>6CTE_1 Immunoglobulin G-binding protein G (chains A, B)
GQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGMDGEWTYDDATKTFTVTE
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| PO4 | Phosphate ion | O4 P | 6 |
| MRD | (4R)-2-methylpentane-2,4-diol | C6 H14 O2 | 1 |
Water and common crystallization additives (MPD, ACT) are not listed.
Primary citation
77Se NMR Probes the Protein Environment of Selenomethionine. Chen, Q., Xu, S., Lu, X. et al. J Phys Chem B (2020) 124:601-616. DOI 10.1021/acs.jpcb.9b07466 · PubMed
Other PDB entries of the same protein (UniProt P19909 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3FIL 0.88 Å, Structural and energetic determinants for hyperstable variants of GB1 obtained from…
- 2QMT 1.05 Å, Crystal Polymorphism of Protein GB1 Examined by Solid-state NMR and X-ray Diffraction
- 9I2I 1.08 Å, X-ray structure of the B1 domain of streptococcal protein G triple mutant T2Q, N8D, and…
- 6CHE 1.1 Å, Selenomethionine mutant (A34Sem) of protein GB1 examined by X-ray diffraction
- 6CPZ 1.12 Å, Selenomethionine mutant (I6Sem) of protein GB1 examined by X-ray diffraction
- 2GI9 1.14 Å, Backbone Conformational Constraints in a Microcrystalline U-15N-Labeled Protein by 3D…
- 6C9O 1.2 Å, Selenomethionine mutant (V29Sem) of protein GB1 examined by X-ray diffraction
- 6OC7 1.3 Å, HMP42 Fab in complex with Protein G
- 6NLA 1.34 Å, Crystal structure of de novo designed metal-controlled dimer of B1…
- 2ON8 1.35 Å, Gbeta1 stabilization by in vitro evolution and computational design
- 12LO 1.37 Å, X-ray crystal structure of Protein GB1 mutant K13A
- 6NL6 1.4 Å, Crystal structure of mutant B1 immunoglobulin-binding domain of Streptococcal Protein G…
Browse structure collections
About this viewer
MolViewer shows 6CTE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.