X-ray structure of the B1 domain of streptococcal protein G triple mutant T2Q, N8D, and N37D (GB1-QDD). Determined by X-ray diffraction at 1.08 Å resolution. Released 3 Sept 2025.
Explore 9I2I in 3D Show helices and sheets RCSB PDB PDBe
9I2I contains 4 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 12-19 | 8 | 1 |
| α-helix | 23-36 | 14 | |
| β-strand | 42-46 | 5 | 1 |
| α-helix | 47-49 | 3 | |
| β-strand | 51-55 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 12-19 | 8 | 1 |
| α-helix | 23-35 | 13 | |
| β-strand | 42-46 | 5 | 1 |
| α-helix | 47-49 | 3 | |
| β-strand | 51-55 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunoglobulin G-binding protein G | A, B | protein | 56 | Streptococcus sp. | P19909 (AlphaFold model) |
>9I2I_1 Immunoglobulin G-binding protein G (chains A, B) MQYKLILDGKTLKGETTTEAVDAATAEKVFKQYANDDGVDGEWTYDDATKTFTVTE
Aromatic ring flips reveal reshaping of protein dynamics in crystals and complexes. Becker, L.M., Fu, H., Tatman, B.P. et al. Nat Chem (2026) 18:1221-1230. DOI 10.1038/s41557-026-02155-0 · PubMed
Other PDB entries of the same protein (UniProt P19909 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9I2I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.