6CXJ: Actin, cytoplasmic 2
Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C mode 2. Determined by electron microscopy at 11.0 Å resolution. Released 10 Oct 2018.
- Method
- Electron microscopy
- Resolution
- 11.0 Å
- Organism
- Homo sapiens
- Chains
- 20
- Atoms
- 25,305
- Mol. weight
- 379.11 kDa
- Released
- 10 Oct 2018
Explore 6CXJ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6CXJ contains 137 α-helices and 198 β-strands across 20 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 22 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-11 | 5 | 1 |
| β-strand | 15-20 | 6 | 1 |
| β-strand | 28-31 | 4 | 1 |
| β-strand | 34-37 | 4 | 2 |
| β-strand | 52-53 | 2 | 2 |
| α-helix | 55-59 | 5 | |
| β-strand | 64-67 | 4 | 2 |
| β-strand | 70-71 | 2 | 3 |
| β-strand | 74-75 | 2 | 3 |
| α-helix | 78-86 | 9 | |
| α-helix | 87-92 | 6 | |
| β-strand | 102-106 | 5 | 1 |
| α-helix | 112-124 | 13 | |
| β-strand | 130-135 | 6 | 1 |
| α-helix | 136-144 | 9 | |
| β-strand | 149-153 | 5 | 4 |
| β-strand | 159-165 | 7 | 4 |
| β-strand | 168-169 | 2 | 4 |
| α-helix | 171-173 | 3 | |
| β-strand | 175-177 | 3 | 4 |
| α-helix | 181-195 | 15 | |
| α-helix | 202-214 | 13 | |
| α-helix | 222-228 | 7 | |
| α-helix | 229-231 | 3 | |
| β-strand | 237-240 | 4 | 5 |
| α-helix | 241 | 1 | |
| β-strand | 246-249 | 4 | 5 |
| α-helix | 251-261 | 11 | |
| α-helix | 263-265 | 3 | |
| α-helix | 273-283 | 11 | |
| α-helix | 286-294 | 9 | |
| β-strand | 296-299 | 4 | 4 |
| α-helix | 301-303 | 3 | |
| α-helix | 308-319 | 12 | |
| β-strand | 328-329 | 2 | 4 |
| α-helix | 334-336 | 3 | |
| α-helix | 337-347 | 11 | |
| α-helix | 349-354 | 6 | |
| β-strand | 356-357 | 2 | 1 |
| α-helix | 358-364 | 7 | |
| α-helix | 368-372 | 5 | |
Chain B: 22 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-10 | 4 | 6 |
| β-strand | 15-20 | 6 | 6 |
| β-strand | 28-31 | 4 | 6 |
| β-strand | 34-37 | 4 | 7 |
| α-helix | 40-41 | 2 | |
| β-strand | 52-53 | 2 | 7 |
| α-helix | 55-59 | 5 | |
| β-strand | 64-67 | 4 | 7 |
| β-strand | 70-71 | 2 | 8 |
| β-strand | 74-75 | 2 | 8 |
| α-helix | 78-87 | 10 | |
| α-helix | 88-92 | 5 | |
| β-strand | 102-106 | 5 | 6 |
| α-helix | 112-125 | 14 | |
| β-strand | 130-135 | 6 | 6 |
| α-helix | 136-144 | 9 | |
| β-strand | 149-154 | 6 | 9 |
| β-strand | 159-165 | 7 | 9 |
| β-strand | 168-169 | 2 | 9 |
| α-helix | 171-173 | 3 | |
| β-strand | 175-177 | 3 | 9 |
| α-helix | 181-194 | 14 | |
| α-helix | 202-214 | 13 | |
| α-helix | 222-227 | 6 | |
| α-helix | 228-231 | 4 | |
| β-strand | 237-240 | 4 | 10 |
| α-helix | 241 | 1 | |
| β-strand | 246-249 | 4 | 10 |
| α-helix | 251-261 | 11 | |
| α-helix | 263-265 | 3 | |
| α-helix | 273-283 | 11 | |
| α-helix | 286-293 | 8 | |
| β-strand | 296-297 | 2 | 11 |
| α-helix | 301-303 | 3 | |
| α-helix | 308-319 | 12 | |
| β-strand | 328-329 | 2 | 11 |
| α-helix | 337-345 | 9 | |
| α-helix | 349-354 | 6 | |
| β-strand | 356-357 | 2 | 6 |
| α-helix | 358-364 | 7 | |
| α-helix | 368-372 | 5 | |
Chain C: 19 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-11 | 5 | 12 |
| β-strand | 15-20 | 6 | 12 |
| β-strand | 28-31 | 4 | 12 |
| β-strand | 34-37 | 4 | 13 |
| β-strand | 52-53 | 2 | 13 |
| α-helix | 55-59 | 5 | |
| β-strand | 64-67 | 4 | 13 |
| β-strand | 70-71 | 2 | 14 |
| β-strand | 74-75 | 2 | 14 |
| α-helix | 78-86 | 9 | |
| α-helix | 87-92 | 6 | |
| β-strand | 102-106 | 5 | 12 |
| α-helix | 112-124 | 13 | |
| β-strand | 130-135 | 6 | 12 |
| α-helix | 136-144 | 9 | |
| β-strand | 149-154 | 6 | 15 |
| β-strand | 159-165 | 7 | 15 |
| β-strand | 168-169 | 2 | 15 |
| α-helix | 171-173 | 3 | |
| β-strand | 175-177 | 3 | 15 |
| α-helix | 181-195 | 15 | |
| α-helix | 202-214 | 13 | |
| α-helix | 222-228 | 7 | |
| β-strand | 237-240 | 4 | 16 |
| β-strand | 246-249 | 4 | 16 |
| α-helix | 252-261 | 10 | |
| α-helix | 263-265 | 3 | |
| α-helix | 273-283 | 11 | |
| α-helix | 286-294 | 9 | |
| β-strand | 296-299 | 4 | 15 |
| α-helix | 301-303 | 3 | |
| α-helix | 308-319 | 12 | |
| β-strand | 328-329 | 2 | 15 |
| α-helix | 337-347 | 11 | |
| α-helix | 349-354 | 6 | |
| β-strand | 356-357 | 2 | 12 |
| α-helix | 358-364 | 7 | |
| α-helix | 368-372 | 5 | |
Chain D: 21 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-12 | 6 | 17 |
| β-strand | 15-20 | 6 | 17 |
| β-strand | 28-31 | 4 | 17 |
| β-strand | 34-37 | 4 | 18 |
| α-helix | 40-41 | 2 | |
| β-strand | 52-53 | 2 | 18 |
| α-helix | 55-59 | 5 | |
| β-strand | 64-67 | 4 | 18 |
| β-strand | 70-71 | 2 | 19 |
| β-strand | 74-75 | 2 | 19 |
| α-helix | 78-86 | 9 | |
| α-helix | 87-92 | 6 | |
| β-strand | 102-106 | 5 | 17 |
| α-helix | 112-124 | 13 | |
| β-strand | 130-135 | 6 | 17 |
| α-helix | 136-144 | 9 | |
| β-strand | 149-154 | 6 | 20 |
| β-strand | 159-165 | 7 | 20 |
| β-strand | 168-169 | 2 | 20 |
| α-helix | 171-173 | 3 | |
| β-strand | 175-177 | 3 | 20 |
| α-helix | 181-195 | 15 | |
| α-helix | 202-214 | 13 | |
| α-helix | 222-228 | 7 | |
| α-helix | 229-231 | 3 | |
| β-strand | 237-240 | 4 | 21 |
| β-strand | 246-249 | 4 | 21 |
| α-helix | 251-261 | 11 | |
| α-helix | 263-265 | 3 | |
| α-helix | 273-283 | 11 | |
| α-helix | 286-294 | 9 | |
| β-strand | 296-299 | 4 | 20 |
| α-helix | 301-303 | 3 | |
| α-helix | 308-319 | 12 | |
| β-strand | 328-329 | 2 | 20 |
| α-helix | 337-347 | 11 | |
| α-helix | 349-354 | 6 | |
| β-strand | 356-357 | 2 | 17 |
| α-helix | 358-363 | 6 | |
| α-helix | 368-372 | 5 | |
Chain E: 20 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-11 | 5 | 22 |
| β-strand | 15-20 | 6 | 22 |
| β-strand | 28-31 | 4 | 22 |
| β-strand | 34-37 | 4 | 23 |
| α-helix | 40-41 | 2 | |
| β-strand | 52-53 | 2 | 23 |
| α-helix | 55-59 | 5 | |
| β-strand | 64-67 | 4 | 23 |
| β-strand | 70-71 | 2 | 24 |
| β-strand | 74-75 | 2 | 24 |
| α-helix | 78-87 | 10 | |
| α-helix | 88-92 | 5 | |
| β-strand | 102-106 | 5 | 22 |
| α-helix | 112-124 | 13 | |
| β-strand | 130-135 | 6 | 22 |
| α-helix | 136-144 | 9 | |
| β-strand | 149-154 | 6 | 25 |
| β-strand | 159-165 | 7 | 25 |
| β-strand | 168-169 | 2 | 25 |
| β-strand | 175-177 | 3 | 25 |
| α-helix | 181-195 | 15 | |
| α-helix | 202-214 | 13 | |
| α-helix | 222-228 | 7 | |
| α-helix | 229-231 | 3 | |
| β-strand | 237-240 | 4 | 26 |
| α-helix | 241 | 1 | |
| β-strand | 246-249 | 4 | 26 |
| α-helix | 252-261 | 10 | |
| α-helix | 273-283 | 11 | |
| α-helix | 286-294 | 9 | |
| β-strand | 296-300 | 5 | 25 |
| α-helix | 301-303 | 3 | |
| α-helix | 308-319 | 12 | |
| β-strand | 328-329 | 2 | 25 |
| α-helix | 337-345 | 9 | |
| α-helix | 349-354 | 6 | |
| β-strand | 356-357 | 2 | 22 |
| α-helix | 358-364 | 7 | |
| α-helix | 368-372 | 5 | |
Chain G: 3 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 152-154 | 3 | |
| β-strand | 157-159 | 3 | 27 |
| β-strand | 164-167 | 4 | 28 |
| β-strand | 172-179 | 8 | 27 |
| β-strand | 188-193 | 6 | 28 |
| β-strand | 197-198 | 2 | 28 |
| α-helix | 199-202 | 4 | |
| β-strand | 207-214 | 8 | 27 |
| β-strand | 219-226 | 8 | 27 |
| α-helix | 231-233 | 3 | |
| β-strand | 235-242 | 8 | 28 |
| β-strand | 247-257 | 11 | 28 |
Chain H: 3 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 157-159 | 3 | 29 |
| β-strand | 164-167 | 4 | 30 |
| β-strand | 172-179 | 8 | 29 |
| α-helix | 186-187 | 2 | |
| β-strand | 188-193 | 6 | 30 |
| β-strand | 197-198 | 2 | 30 |
| α-helix | 199-202 | 4 | |
| β-strand | 207-214 | 8 | 29 |
| β-strand | 219-226 | 8 | 29 |
| α-helix | 231-233 | 3 | |
| β-strand | 235-242 | 8 | 30 |
| β-strand | 247-257 | 11 | 30 |
Chain I: 3 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 152-154 | 3 | |
| β-strand | 157-159 | 3 | 31 |
| β-strand | 164-166 | 3 | 32 |
| β-strand | 172-179 | 8 | 31 |
| β-strand | 188-193 | 6 | 32 |
| β-strand | 197-198 | 2 | 32 |
| α-helix | 199-202 | 4 | |
| β-strand | 207-214 | 8 | 31 |
| β-strand | 219-226 | 8 | 31 |
| α-helix | 231-233 | 3 | |
| β-strand | 235-242 | 8 | 32 |
| β-strand | 247-256 | 10 | 32 |
11 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Actin, cytoplasmic 2 | A, B, C, D, E | protein | 375 | Homo sapiens | P63261 (AlphaFold model) |
| Myosin-binding protein C, cardiac-type | G, H, I, J, K, L | protein | 109 | Homo sapiens | Q14896 (AlphaFold model) |
| Myosin-binding protein C, cardiac-type | M, N, O, P, Q | protein | 101 | Homo sapiens | Q14896 (AlphaFold model) |
| Tropomyosin | S, T, U, V | protein | 127 | Homo sapiens | |
Sequence of entity 1 (A, B, C, D, E), FASTA
>6CXJ_1 Actin, cytoplasmic 2 (chains A, B, C, D, E)
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
Sequence of entity 2 (G, H, I, J, K, L), FASTA
>6CXJ_2 Myosin-binding protein C, cardiac-type (chains G, H, I, J, K, L)
MDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQL
HDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHE
Sequence of entity 3 (M, N, O, P, Q), FASTA
>6CXJ_3 Myosin-binding protein C, cardiac-type (chains M, N, O, P, Q)
MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATE
GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAE
Sequence of entity 4 (S, T, U, V), FASTA
>6CXJ_4 Tropomyosin (chains S, T, U, V)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXX
Primary citation
N-Terminal Domains of Cardiac Myosin Binding Protein C Cooperatively Activate the Thin Filament. Risi, C., Belknap, B., Forgacs-Lonart, E. et al. Structure (2018) 26:1604. DOI 10.1016/j.str.2018.08.007 · PubMed
Other PDB entries of the same protein (UniProt P63261 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6WK2 1.76 Å, SETD3 mutant (N255V) in Complex with an Actin Peptide with His73 Replaced with Methionine
- 6WK1 1.89 Å, SETD3 in Complex with an Actin Peptide with His73 Replaced with Methionine
- 6V63 2.02 Å, SETD3 WT in Complex with an Actin Peptide with His73 Replaced with Glutamine
- 6V62 2.36 Å, SETD3 double mutant (N255F/W273A) in Complex with an Actin Peptide with His73 Replaced…
- 7NVM 3.1 Å, Human TRiC complex in closed state with nanobody Nb18, actin and PhLP2A bound
- 8DNF 3.38 Å, Cryo-EM structure of nonmuscle gamma-actin
- 9SMX 3.67 Å, CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules
- 5JLH 3.9 Å, Cryo-EM structure of a human cytoplasmic actomyosin complex at near-atomic resolution
- 6G2T 9.0 Å, human cardiac myosin binding protein C C1 Ig-domain bound to native cardiac thin filament
- 6CXI 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
Browse structure collections
About this viewer
MolViewer shows 6CXJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.