SETD3 double mutant (N255F/W273A) in Complex with an Actin Peptide with His73 Replaced with Lysine. Determined by X-ray diffraction at 2.36 Å resolution. Released 15 Jan 2020.
Explore 6V62 in 3D Show helices and sheets RCSB PDB PDBe
6V62 contains 28 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-35 | 15 | |
| α-helix | 42-44 | 3 | |
| α-helix | 45-60 | 16 | |
| α-helix | 74-77 | 4 | |
| α-helix | 78-86 | 9 | |
| β-strand | 95-100 | 6 | 2 |
| β-strand | 104-109 | 6 | 2 |
| β-strand | 113 | 1 | 3 |
| β-strand | 118-123 | 6 | 1 |
| α-helix | 124-126 | 3 | |
| β-strand | 128-129 | 2 | 4 |
| α-helix | 130-134 | 5 | |
| α-helix | 139-144 | 6 | |
| α-helix | 146-150 | 5 | |
| α-helix | 152-164 | 13 | |
| α-helix | 172-175 | 4 | |
| α-helix | 185-187 | 3 | |
| α-helix | 190-194 | 5 | |
| α-helix | 202-225 | 24 | |
| α-helix | 227-229 | 3 | |
| α-helix | 233-235 | 3 | |
| α-helix | 240-253 | 14 | |
| β-strand | 255-258 | 4 | 4 |
| β-strand | 265-269 | 5 | 4 |
| α-helix | 273-275 | 3 | |
| β-strand | 277-278 | 2 | 5 |
| β-strand | 285-288 | 4 | 1 |
| β-strand | 293-297 | 5 | 1 |
| β-strand | 302 | 1 | 3 |
| β-strand | 307-308 | 2 | 2 |
| β-strand | 309-310 | 2 | 5 |
| α-helix | 317-319 | 3 | |
| α-helix | 320-324 | 5 | |
| β-strand | 335-341 | 7 | 6 |
| α-helix | 349-358 | 10 | |
| β-strand | 364-370 | 7 | 6 |
| α-helix | 378-387 | 10 | |
| α-helix | 391-396 | 6 | |
| α-helix | 403-408 | 6 | |
| α-helix | 419-437 | 19 | |
| α-helix | 444-453 | 10 | |
| α-helix | 458-493 | 36 | |
| α-helix | 496-499 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 70 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Actin, cytoplasmic 1 | Y | protein | 23 | Homo sapiens | P63261 (AlphaFold model) |
| Actin-histidine N-methyltransferase | A | protein | 596 | Homo sapiens | Q86TU7 (AlphaFold model) |
>6V62_1 Actin, cytoplasmic 1 (chains Y) TLKYPIEKGIVTNWDDMEKIWHH
>6V62_2 Actin-histidine N-methyltransferase (chains A) GSMGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVE KIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEE LFLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQT LPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDS FTYEDYRWAVSSVMTRQFQIPTEDGSRVTLALIPLADMCNHTNGLITTGYNLEDDRCECV ALQDFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLA RAGIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPV SWDNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKA VKSAAVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLPLVLRNLEEEAGVQDALNI REAISKAKATENGLVNGENSIPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 1 |
Water and common crystallization additives (EDO) are not listed.
An engineered variant of SETD3 methyltransferase alters target specificity from histidine to lysine methylation. Dai, S., Horton, J.R., Wilkinson, A.W. et al. J Biol Chem (2020) 295:2582-2589. DOI 10.1074/jbc.RA119.012319 · PubMed
Other PDB entries of the same protein (UniProt P63261 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6V62 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.