6CXW: Synaptotagmin 1 C2A beta4 chimera

Synaptotagmin 1 C2A beta4 chimera with enhanced PIP2 binding function. Determined by X-ray diffraction at 1.83 Å resolution. Released 17 Apr 2019.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 1,162
Mol. weight: 14.69 kDa
Released: 17 Apr 2019

Explore 6CXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CXW contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	144-152	9	1
β-strand	157-166	10	1
β-strand	179-187	9	2
β-strand	190-196	7	2
α-helix	197-199	3
β-strand	207-215	9	1
α-helix	218-220	3
β-strand	224-232	9	2
β-strand	240-248	9	2
β-strand	258-263	6	1
β-strand	265	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Synaptotagmin 1 C2A beta4 chimera	A	protein	128	Rattus norvegicus	P21707 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6CXW_1 Synaptotagmin 1 C2A beta4 chimera (chains A)
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKIHLMQNGKRLKKKKTTI
KKNTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTE
EWRDLQSA

Primary citation

Engineering a C2-domain to bind PIP2. Evans, C.S., Lou, X., Bai, H. et al. To be published.

Other PDB entries of the same protein (UniProt P21707 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WEE 0.89 Å, High-resolution structure of Synaptotagmin 1 C2A
1TJX 1.04 Å, Crystallographic Identification of Ca2+ Coordination Sites in Synaptotagmin I C2B Domain
1UOW 1.04 Å, Calcium binding domain C2B
1TJM 1.18 Å, Crystallographic Identification of Sr2+ Coordination Site in Synaptotagmin I C2B Domain
2YOA 1.5 Å, Synaptotagmin-1 C2B domain with phosphoserine
1UOV 1.65 Å, Calcium binding domain C2B
5CCJ 1.65 Å, Crystal structure of the quintuple mutant of the synaptotagmin-1 C2B domain
8C5H 1.68 Å, NbSyt1 anti-(rat Synaptotagmin-1) nanobody bound to target cytosolic domain of…
5W5C 1.85 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2AB complex
1RSY 1.9 Å, Structure of the first C2-domain of synaptotagmin I: a novel CA2+(SLASH)PHOSPHOLIPID…
5W5D 2.5 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2B complex
5CCG 3.5 Å, Structure of the Ca2+-bound synaptotagmin-1 SNARE complex (long unit cell form)

Browse structure collections

About this viewer

MolViewer shows 6CXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.