6D58: Fc fragment of Human IgG3

Crystal structure of a Fc fragment of Human IgG3. Determined by X-ray diffraction at 2.39 Å resolution. Released 15 May 2019.

Method: X-ray diffraction
Resolution: 2.39 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,538
Mol. weight: 51.43 kDa
Released: 15 May 2019

Explore 6D58 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6D58 contains 19 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	1
α-helix	247-251	5
β-strand	258-266	9	1
β-strand	274-279	6	2
β-strand	282-284	3	2
β-strand	288-289	2	1
α-helix	290-292	3
β-strand	293-294	2	1
β-strand	300-307	8	1
α-helix	310-314	5
β-strand	319-324	6	2
β-strand	332-336	5	2
α-helix	339	1
β-strand	344	1	3
β-strand	347-351	5	4
α-helix	352-354	3
α-helix	355-359	5
β-strand	362-372	11	4
β-strand	373	1	3
β-strand	378-382	5	5
β-strand	387	1	5
β-strand	391-393	3	4
α-helix	394-396	3
β-strand	397-398	2	4
β-strand	404-413	10	4
α-helix	414-419	6
β-strand	423-428	6	5
α-helix	433-435	3
β-strand	436-441	6	5

Chain B: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	6
α-helix	247-251	5
β-strand	258-264	7	6
β-strand	266	1	7
β-strand	276-279	4	8
β-strand	287-289	3	6
β-strand	300	1	7
β-strand	303-307	5	6
α-helix	310-313	4
β-strand	319-322	4	8
β-strand	323	1	9
β-strand	332	1	9
β-strand	335-336	2	8
α-helix	338-340	3
β-strand	344	1	10
α-helix	345-346	2
β-strand	347-351	5	11
α-helix	352-354	3
α-helix	355-359	5
β-strand	362-372	11	11
β-strand	373	1	10
β-strand	378-383	6	12
β-strand	386-387	2	12
α-helix	388	1
β-strand	391-393	3	11
α-helix	394-396	3
β-strand	397-398	2	11
β-strand	404-413	10	11
α-helix	414-420	7
β-strand	423-428	6	12
α-helix	433-435	3
β-strand	436-441	6	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin heavy constant gamma 3	A, B	protein	214	Homo sapiens	P01860 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6D58_1 Immunoglobulin heavy constant gamma 3 (chains A, B)
LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPRE
EQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPP
SREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVD
KSRWQQGNIFSCSVMHEALHNHFTQKSLSLSPGK

Primary citation

Crystal structure of a Fc fragment of Human IgG3. Gohain, N., Tolbert, W.D., Pazgier, M. To be published.

Other PDB entries of the same protein (UniProt P01860 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W38 1.8 Å, 1.80A resolution structure of human IgG3 Fc (N392K)
6G1E 1.88 Å, BEAT Fc with improved heterodimerization (Q3A-D84.4Q)
5M3V 1.97 Å, BEAT Fc
4ZNC 2.28 Å, Fc fragment of human IgG in complex with the C domain of staphylococcal protein A mutant…
4WWI 2.31 Å, Crystal structure of the C domain of staphylococcal protein A in complex with the Fc…

Browse structure collections

About this viewer

MolViewer shows 6D58 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.