Crystal structure of a Fc fragment of Human IgG3. Determined by X-ray diffraction at 2.39 Å resolution. Released 15 May 2019.
Explore 6D58 in 3D Show helices and sheets RCSB PDB PDBe
6D58 contains 19 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 239-243 | 5 | 1 |
| α-helix | 247-251 | 5 | |
| β-strand | 258-266 | 9 | 1 |
| β-strand | 274-279 | 6 | 2 |
| β-strand | 282-284 | 3 | 2 |
| β-strand | 288-289 | 2 | 1 |
| α-helix | 290-292 | 3 | |
| β-strand | 293-294 | 2 | 1 |
| β-strand | 300-307 | 8 | 1 |
| α-helix | 310-314 | 5 | |
| β-strand | 319-324 | 6 | 2 |
| β-strand | 332-336 | 5 | 2 |
| α-helix | 339 | 1 | |
| β-strand | 344 | 1 | 3 |
| β-strand | 347-351 | 5 | 4 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-359 | 5 | |
| β-strand | 362-372 | 11 | 4 |
| β-strand | 373 | 1 | 3 |
| β-strand | 378-382 | 5 | 5 |
| β-strand | 387 | 1 | 5 |
| β-strand | 391-393 | 3 | 4 |
| α-helix | 394-396 | 3 | |
| β-strand | 397-398 | 2 | 4 |
| β-strand | 404-413 | 10 | 4 |
| α-helix | 414-419 | 6 | |
| β-strand | 423-428 | 6 | 5 |
| α-helix | 433-435 | 3 | |
| β-strand | 436-441 | 6 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 239-243 | 5 | 6 |
| α-helix | 247-251 | 5 | |
| β-strand | 258-264 | 7 | 6 |
| β-strand | 266 | 1 | 7 |
| β-strand | 276-279 | 4 | 8 |
| β-strand | 287-289 | 3 | 6 |
| β-strand | 300 | 1 | 7 |
| β-strand | 303-307 | 5 | 6 |
| α-helix | 310-313 | 4 | |
| β-strand | 319-322 | 4 | 8 |
| β-strand | 323 | 1 | 9 |
| β-strand | 332 | 1 | 9 |
| β-strand | 335-336 | 2 | 8 |
| α-helix | 338-340 | 3 | |
| β-strand | 344 | 1 | 10 |
| α-helix | 345-346 | 2 | |
| β-strand | 347-351 | 5 | 11 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-359 | 5 | |
| β-strand | 362-372 | 11 | 11 |
| β-strand | 373 | 1 | 10 |
| β-strand | 378-383 | 6 | 12 |
| β-strand | 386-387 | 2 | 12 |
| α-helix | 388 | 1 | |
| β-strand | 391-393 | 3 | 11 |
| α-helix | 394-396 | 3 | |
| β-strand | 397-398 | 2 | 11 |
| β-strand | 404-413 | 10 | 11 |
| α-helix | 414-420 | 7 | |
| β-strand | 423-428 | 6 | 12 |
| α-helix | 433-435 | 3 | |
| β-strand | 436-441 | 6 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunoglobulin heavy constant gamma 3 | A, B | protein | 214 | Homo sapiens | P01860 (AlphaFold model) |
>6D58_1 Immunoglobulin heavy constant gamma 3 (chains A, B) LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPRE EQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVD KSRWQQGNIFSCSVMHEALHNHFTQKSLSLSPGK
Crystal structure of a Fc fragment of Human IgG3. Gohain, N., Tolbert, W.D., Pazgier, M. To be published.
Other PDB entries of the same protein (UniProt P01860 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6D58 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.