6D83: Bone marrow stromal antigen 2,Protein Nef
Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant dimer monomeric subunit. Determined by electron microscopy at 4.27 Å resolution. Released 8 Aug 2018.
- Method
- Electron microscopy
- Resolution
- 4.27 Å
- Organisms
- Homo sapiens, Human immunodeficiency virus 1, Mus musculus
- Chains
- 8
- Atoms
- 16,588
- Mol. weight
- 306.76 kDa
- Ligands
- GTP, MG
- Released
- 8 Aug 2018
Explore 6D83 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6D83 contains 111 α-helices and 59 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain B: 41 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 15-22 | 8 | |
| α-helix | 27-43 | 17 | |
| α-helix | 48-50 | 3 | |
| α-helix | 51-54 | 4 | |
| α-helix | 56-58 | 3 | |
| α-helix | 66-75 | 10 | |
| α-helix | 84-87 | 4 | |
| α-helix | 88-94 | 7 | |
| α-helix | 100-112 | 13 | |
| α-helix | 123-130 | 8 | |
| α-helix | 135-151 | 17 | |
| α-helix | 153-158 | 6 | |
| α-helix | 161-167 | 7 | |
| α-helix | 174-190 | 17 | |
| α-helix | 201-209 | 9 | |
| α-helix | 218-221 | 4 | |
| α-helix | 235-244 | 10 | |
| α-helix | 245-249 | 5 | |
| β-strand | 250 | 1 | 1 |
| α-helix | 255-266 | 12 | |
| α-helix | 276-290 | 15 | |
| α-helix | 291-293 | 3 | |
| α-helix | 296-312 | 17 | |
| α-helix | 322-324 | 3 | |
| α-helix | 332-345 | 14 | |
| α-helix | 351-359 | 9 | |
| α-helix | 367-383 | 17 | |
| α-helix | 388-399 | 12 | |
| α-helix | 404-420 | 17 | |
| α-helix | 429-432 | 4 | |
| α-helix | 442-454 | 13 | |
| α-helix | 462-466 | 5 | |
| α-helix | 473-475 | 3 | |
| α-helix | 479-494 | 16 | |
| α-helix | 500-508 | 9 | |
| α-helix | 509-513 | 5 | |
| α-helix | 517-532 | 16 | |
| α-helix | 537-540 | 4 | |
| α-helix | 545-549 | 5 | |
| α-helix | 554-556 | 3 | |
| α-helix | 557-564 | 8 | |
| β-strand | 569 | 1 | 2 |
| α-helix | 570-572 | 3 | |
Chain C: 7 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 19-22 | 4 | 3 |
| β-strand | 23 | 1 | 4 |
| α-helix | 30-38 | 9 | |
| β-strand | 51-58 | 8 | 3 |
| β-strand | 61-68 | 8 | 3 |
| α-helix | 75-78 | 4 | |
| β-strand | 90-93 | 4 | 4 |
| α-helix | 97-110 | 14 | |
| α-helix | 119-121 | 3 | |
| β-strand | 123-126 | 4 | 4 |
| α-helix | 138-143 | 6 | |
| α-helix | 145-147 | 3 | |
| β-strand | 155-158 | 4 | 4 |
| α-helix | 166-177 | 12 | |
Chain G: 38 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-15 | 9 | |
| α-helix | 20-38 | 19 | |
| α-helix | 46-59 | 14 | |
| α-helix | 68-74 | 7 | |
| α-helix | 79-92 | 14 | |
| α-helix | 95-97 | 3 | |
| α-helix | 100-102 | 3 | |
| α-helix | 103-110 | 8 | |
| α-helix | 116-129 | 14 | |
| α-helix | 132-142 | 11 | |
| α-helix | 144-146 | 3 | |
| α-helix | 151-167 | 17 | |
| α-helix | 169-171 | 3 | |
| α-helix | 188-204 | 17 | |
| α-helix | 206-212 | 7 | |
| α-helix | 216-227 | 12 | |
| β-strand | 236-237 | 2 | 5 |
| β-strand | 240-241 | 2 | 5 |
| α-helix | 243-254 | 12 | |
| α-helix | 262-266 | 5 | |
| α-helix | 268-274 | 7 | |
| α-helix | 283-298 | 16 | |
| α-helix | 303-316 | 14 | |
| α-helix | 322-334 | 13 | |
| α-helix | 340-343 | 4 | |
| α-helix | 344-346 | 3 | |
| α-helix | 347-352 | 6 | |
| α-helix | 353-355 | 3 | |
| α-helix | 359-372 | 14 | |
| α-helix | 378-390 | 13 | |
| α-helix | 397-410 | 14 | |
| α-helix | 415-428 | 14 | |
| α-helix | 438-447 | 10 | |
| α-helix | 453-463 | 11 | |
| α-helix | 470-487 | 18 | |
| α-helix | 504-514 | 11 | |
| α-helix | 522-536 | 15 | |
| α-helix | 544-550 | 7 | |
| α-helix | 557-572 | 16 | |
| α-helix | 582-586 | 5 | |
Chain H: 7 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 18-24 | 7 | 6 |
| α-helix | 30-38 | 9 | |
| β-strand | 51-57 | 7 | 6 |
| β-strand | 62-68 | 7 | 6 |
| α-helix | 75-81 | 7 | |
| β-strand | 87-92 | 6 | 6 |
| α-helix | 97-99 | 3 | |
| α-helix | 100-110 | 11 | |
| β-strand | 120-125 | 6 | 6 |
| α-helix | 136-143 | 8 | |
| α-helix | 145-147 | 3 | |
| β-strand | 153 | 1 | 6 |
| β-strand | 156-157 | 2 | 6 |
| β-strand | 159 | 1 | 7 |
| β-strand | 164 | 1 | 7 |
| α-helix | 166-177 | 12 | |
Chain M: 12 helices, 31 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-9 | 5 | 8 |
| β-strand | 15-20 | 6 | 8 |
| α-helix | 27-32 | 6 | |
| α-helix | 33-41 | 9 | |
| β-strand | 49-52 | 4 | 8 |
| β-strand | 55-61 | 7 | 8 |
| β-strand | 66-71 | 6 | 8 |
| β-strand | 76 | 1 | 2 |
| α-helix | 77-94 | 18 | |
| α-helix | 100-103 | 4 | |
| α-helix | 107-116 | 10 | |
| β-strand | 118-119 | 2 | 9 |
| β-strand | 122-123 | 2 | 9 |
| α-helix | 128-132 | 5 | |
| α-helix | 148-150 | 3 | |
| α-helix | 151-153 | 3 | |
| β-strand | 170-183 | 14 | 1 |
| β-strand | 189-202 | 14 | 1 |
| β-strand | 209-214 | 6 | 10 |
| β-strand | 216 | 1 | 11 |
| α-helix | 217-223 | 7 | |
| β-strand | 231 | 1 | 11 |
| β-strand | 236-238 | 3 | 1 |
| β-strand | 242 | 1 | 10 |
| α-helix | 244-250 | 7 | |
| β-strand | 253-255 | 3 | 10 |
| β-strand | 260-270 | 11 | 1 |
| α-helix | 274-275 | 2 | |
| β-strand | 277-280 | 4 | 12 |
| β-strand | 283 | 1 | 12 |
| β-strand | 286 | 1 | 13 |
| β-strand | 290 | 1 | 13 |
| β-strand | 292-299 | 8 | 12 |
| β-strand | 306-315 | 10 | 1 |
| β-strand | 321-326 | 6 | 12 |
| β-strand | 331-335 | 5 | 1 |
| β-strand | 340-349 | 10 | 1 |
| β-strand | 353-361 | 9 | 12 |
| α-helix | 374-375 | 2 | |
| β-strand | 376-377 | 2 | 1 |
| β-strand | 381-383 | 3 | 1 |
| β-strand | 392-398 | 7 | 10 |
| β-strand | 406-420 | 15 | 1 |
Chain S: 5 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-8 | 5 | 14 |
| β-strand | 14-19 | 6 | 14 |
| α-helix | 25-40 | 16 | |
| β-strand | 49-51 | 3 | 14 |
| β-strand | 55-61 | 7 | 14 |
| β-strand | 66-72 | 7 | 14 |
| α-helix | 78-95 | 18 | |
| α-helix | 100-105 | 6 | |
| α-helix | 107-115 | 9 | |
| β-strand | 118-119 | 2 | 15 |
| β-strand | 122-123 | 2 | 15 |
| α-helix | 130-141 | 12 | |
Chain T: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-10 | 2 | 1 |
| α-helix | 11-12 | 2 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Bone marrow stromal antigen 2,Protein Nef | L, T | protein | 264 | Homo sapiens, Human immunodeficiency virus 1 | Q10589 (AlphaFold model), Q90VU7 |
| AP-1 complex subunit beta-1 | B | protein | 586 | Homo sapiens | Q10567 (AlphaFold model) |
| ADP-ribosylation factor 1 | C, H | protein | 193 | Homo sapiens | P84077 (AlphaFold model) |
| AP-1 complex subunit gamma-1 | G | protein | 601 | Mus musculus | P22892 |
| AP-1 complex subunit mu-1 | M | protein | 423 | Mus musculus | P35585 |
| AP-1 complex subunit sigma-3 | S | protein | 154 | Homo sapiens | Q96PC3 |
Sequence of entity 1 (L, T), FASTA
>6D83_1 Bone marrow stromal antigen 2,Protein Nef (chains L, T)
MSYYHHHHHHDYDIPTTENLYFQGAMGSASTSYDYCRVPMEDGDKRCKGSDEASEGSGMG
GKWSKSSVIGWPAVRERMRRAEPAADGVGAVSRDLEKHGAITSSNTAANNAACAWLEAQE
EEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFP
DWQNYTPGPGVRYPLTFGWCYKLVPVEPDKVEEANKGENTSAAHPVSLHGMDDPEREVLE
WRFDSRLAFHHVARELHPEYFKNC
Sequence of entity 2 (B), FASTA
>6D83_2 AP-1 complex subunit beta-1 (chains B)
GSMTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCM
QTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKI
TEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVA
NAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQ
SICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPEL
QYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAEL
REYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIF
RKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDKST
QVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAK
EVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEG
Sequence of entity 3 (C, H), FASTA
>6D83_3 ADP-ribosylation factor 1 (chains C, H)
MSYYHHHHHHDYDIPTTENLYFQGAMGSEMRILMVGLDAAGKTTILYKLKLGEIVTTIPT
IGFNVETVEYKNISFTVWDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELM
RMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYE
GLDWLSNQLRNQK
Sequence of entity 4 (G), FASTA
>6D83_4 AP-1 complex subunit gamma-1 (chains G)
MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLG
YPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQG
LALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATK
NLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGI
SDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIK
SESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVS
IKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHID
TIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCI
GEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCT
VNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPENLYF
Q
Sequence of entity 5 (M), FASTA
>6D83_5 AP-1 complex subunit mu-1 (chains M)
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWI
KHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDF
GYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIEAVN
LLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQ
CVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQ
FKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRAHF
GLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQL
RTQ
Sequence of entity 6 (S), FASTA
>6D83_6 AP-1 complex subunit sigma-3 (chains S)
MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYK
RYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIG
GEIQETSKKIAVKAIEDSDMLQEVSTVCQTMGER
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 2 |
| MG | Magnesium ion | Mg | 2 |
Primary citation
HIV-1 Nefs Are Cargo-Sensitive AP-1 Trimerization Switches in Tetherin Downregulation. Morris, K.L., Buffalo, C.Z., Sturzel, C.M. et al. Cell (2018) 174:659-671.e14. DOI 10.1016/j.cell.2018.07.004 · PubMed
Other PDB entries of the same protein (UniProt Q10589 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7Q9A 2.1 Å, MHC Class I A02 Allele presenting LLLGIGILVL, in complex with Mel5 TCR
- 3MQ7 2.28 Å, Crystal Structure of Ectodomain Mutant of BST-2/Tetherin/CD317
- 3NWH 2.6 Å, Crystal structure of BST2/Tetherin
- 2X7A 2.77 Å, Structural basis of HIV-1 tethering to membranes by the Bst2-tetherin ectodomain
- 3MQ9 2.8 Å, Crystal Structure of Ectodomain Mutant of BST-2/Tetherin/CD317 Fused to MBP
- 3MQC 2.8 Å, Crystal Structure of Ectodomain of BST-2/Tetherin/CD317 (P21)
- 4P6Z 3.0 Å, Crystal structure of the human BST2 cytoplasmic domain and the HIV-1 Vpu cytoplasmic…
- 3MQB 3.2 Å, Crystal Structure of Ectodomain of BST-2/Tetherin/CD317 (C2)
- 2XG7 3.45 Å, Crystal Structure of BST2-Tetherin Ectodomain expressed in HEK293T cells
- 6CM9 3.73 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef closed trimer monomeric subunit
- 6DFF 3.9 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef monomer
- 6D84 6.72 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant dimer
Browse structure collections
About this viewer
MolViewer shows 6D83 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.