Pekin duck egg lysozyme isoform II (DEL-II). Determined by X-ray diffraction at 1.15 Å resolution. Released 5 Sept 2018.
Explore 6D9I in 3D Show helices and sheets RCSB PDB PDBe
6D9I contains 16 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| α-helix | 5-14 | 10 | |
| β-strand | 20 | 1 | 2 |
| β-strand | 23 | 1 | 2 |
| α-helix | 25-36 | 12 | |
| β-strand | 39 | 1 | 1 |
| β-strand | 43-45 | 3 | 3 |
| β-strand | 51-53 | 3 | 3 |
| β-strand | 58-59 | 2 | 3 |
| β-strand | 65 | 1 | 4 |
| β-strand | 79 | 1 | 4 |
| α-helix | 80-84 | 5 | |
| α-helix | 89-99 | 11 | |
| α-helix | 104-107 | 4 | |
| α-helix | 109-110 | 2 | |
| α-helix | 111-115 | 5 | |
| α-helix | 120-124 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lysozyme | A, B | protein | 129 | Anas platyrhynchos | P00705 (AlphaFold model) |
>6D9I_1 Lysozyme (chains A, B) KVYSRCELAAAMKRLGLDNYRGYSLGNWVCAANYESGFNTQATNRNTDGSTDYGILQINS RWWCDDGKTPRSKNACGIPCSVLLRSDITEAVRCAKRIVSDGNGMNAWVAWRNRCRGTDV SKWIRGCRL
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
Water and common crystallization additives (CL) are not listed.
Crystal structure of duck egg lysozyme isoform II (DEL-II). Langley, D.B., Christ, D. BMC Struct Biol (2018) 18:10-10. DOI 10.1186/s12900-018-0090-7 · PubMed
Other PDB entries of the same protein (UniProt P00705 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6D9I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.