6DC0: PDB entry 6DC0

Tribbles (TRIB1) pseudokinase fused to CCAAT-enhancer binding protein (C/EBPalpha) degron. Determined by X-ray diffraction at 2.8 Å resolution. Released 10 Oct 2018.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,357
Mol. weight: 65.62 kDa
Released: 10 Oct 2018

Explore 6DC0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6DC0 contains 32 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	89-90	2	1
β-strand	94-97	4	1
β-strand	105-110	6	1
β-strand	116-123	8	1
α-helix	124-136	13
α-helix	138-139	2
β-strand	140	1	2
β-strand	143	1	2
β-strand	148-151	4	1
β-strand	155-160	6	1
β-strand	166	1	2
α-helix	167-173	7
α-helix	179-198	20
β-strand	201-202	2	3
α-helix	208-210	3
β-strand	211-213	3	2
β-strand	221-223	3	2
β-strand	230-231	2	3
β-strand	238-239	2	4
β-strand	243-244	2	5
α-helix	246-248	3
α-helix	251-255	5
β-strand	260-261	2	4
α-helix	262-279	18
α-helix	289-298	10
α-helix	309-318	10
α-helix	323-325	3
α-helix	327-328	2
α-helix	329-332	4
α-helix	337-340	4
β-strand	504-505	2	6
α-helix	506-508	3

Chain B: 17 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	90	1	7
β-strand	95-97	3	7
β-strand	105-109	5	7
β-strand	116-123	8	7
α-helix	124-136	13
α-helix	138-139	2
β-strand	140	1	8
β-strand	143	1	8
β-strand	148-151	4	7
β-strand	155-160	6	7
α-helix	161-163	3
β-strand	166	1	8
α-helix	167-173	7
α-helix	179-198	20
β-strand	201-202	2	9
α-helix	208-210	3
β-strand	211-213	3	8
β-strand	221-223	3	8
β-strand	230-231	2	9
β-strand	238-239	2	10
β-strand	243-244	2	6
α-helix	246-248	3
α-helix	251-255	5
β-strand	260-261	2	10
α-helix	262-279	18
α-helix	289-298	10
α-helix	309-318	10
α-helix	323-325	3
α-helix	327-328	2
α-helix	329-332	4
α-helix	337-341	5
β-strand	504-505	2	5
α-helix	506-509	4
α-helix	512-515	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tribbles homolog 1,CCAAT/enhancer-binding protein alpha	A, B	protein	292	Homo sapiens	P49715 (AlphaFold model), Q96RU8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6DC0_1 Tribbles homolog 1,CCAAT/enhancer-binding protein alpha (chains A, B)
SAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNI
TGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVL
GDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGK
AADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREP
SERLTAPEILLHPWFESVLEGSGSSGGPGGGICEHETSIDISAYIDPAAFND

Primary citation

Substrate binding allosterically relieves autoinhibition of the pseudokinase TRIB1. Jamieson, S.A., Ruan, Z., Burgess, A.E. et al. Sci Signal (2018) 11. DOI 10.1126/scisignal.aau0597 · PubMed

Other PDB entries of the same protein (UniProt P49715 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8K8C 2.06 Å, Crystal structure of C/EBPalpha BZIP domain bound to a high affinity DNA

Browse structure collections

About this viewer

MolViewer shows 6DC0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.