6DG1: Second qRRM2 domain of human hnRNP H

NMR structure of the second qRRM2 domain of human hnRNP H. Determined by solution NMR. Released 5 Sept 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 832
Mol. weight: 11.79 kDa
Released: 5 Sept 2018

Explore 6DG1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6DG1 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	112-116	5	1
α-helix	124-130	7
β-strand	136	1	2
β-strand	142	1	1
β-strand	154-158	5	1
β-strand	159	1	2
α-helix	162-169	8
β-strand	172	1	3
β-strand	182	1	3
β-strand	184	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
qRRM2 domain of Heterogeneous nuclear ribonucleoprotein H2	A	protein	105	Homo sapiens	P55795 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6DG1_1 qRRM2 domain of Heterogeneous nuclear ribonucleoprotein H2 (chains A)
SNAMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQG
RSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTH

Primary citation

Differential Conformational Dynamics Encoded by the Inter-qRRM linker of hnRNP H. Penumutchu, S., Chiu, L.Y., Meagher, J.L. et al. J Am Chem Soc (2018). DOI 10.1021/jacs.8b05366 · PubMed

Other PDB entries of the same protein (UniProt P55795 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SGH 3.17 Å, Cryo-EM structure of Karyopherin-beta2 bound to HNRNPH2 PY-NLS
1WEZ Solution structure of RRM domain in heterogeneous nuclear ribonucleoprotein H'
1WG5 Solution structure of the first RRM domain in heterogeneous nuclear ribonucleoprotein H

Browse structure collections

About this viewer

MolViewer shows 6DG1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.