8SGH: Karyopherin-beta2

Cryo-EM structure of Karyopherin-beta2 bound to HNRNPH2 PY-NLS. Determined by electron microscopy at 3.17 Å resolution. Released 14 Jun 2023.

Method: Electron microscopy
Resolution: 3.17 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,831
Mol. weight: 115.73 kDa
Released: 14 Jun 2023

Explore 8SGH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SGH contains 71 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 69 helices, 0 β-strands

Element	Residues	Length
α-helix	17-29	13
α-helix	35-48	14
α-helix	54-63	10
α-helix	70-87	18
α-helix	88-90	3
α-helix	93-105	13
α-helix	112-128	17
α-helix	131-133	3
α-helix	137-145	9
α-helix	150-166	17
α-helix	168-172	5
α-helix	180-189	10
α-helix	190-192	3
α-helix	196-207	12
α-helix	215-218	4
α-helix	221-230	10
α-helix	237-253	17
α-helix	255-258	4
α-helix	259-261	3
α-helix	262-273	12
α-helix	278-293	16
α-helix	297-300	4
α-helix	302-304	3
α-helix	305-315	11
α-helix	318-319	2
α-helix	320-326	7
α-helix	372-379	8
α-helix	383-398	16
α-helix	399-402	4
α-helix	403-413	11
α-helix	419-431	13
α-helix	433-440	8
α-helix	441-443	3
α-helix	444-454	11
α-helix	460-472	13
α-helix	474-479	6
α-helix	482-486	5
α-helix	487-497	11
α-helix	502-519	18
α-helix	520-526	7
α-helix	527-540	14
α-helix	543-560	18
α-helix	561-564	4
α-helix	567-583	17
α-helix	591-605	15
α-helix	606-612	7
α-helix	613-636	24
α-helix	642-644	3
α-helix	646-663	18
α-helix	664-667	4
α-helix	668-671	4
α-helix	676-685	10
α-helix	689-704	16
α-helix	707-710	4
α-helix	711-713	3
α-helix	714-725	12
α-helix	730-747	18
α-helix	748-751	4
α-helix	754-766	13
α-helix	773-789	17
α-helix	791-794	4
α-helix	795-797	3
α-helix	798-809	12
α-helix	816-831	16
α-helix	834-839	6
α-helix	840-848	9
α-helix	855-868	14
α-helix	876-881	6
α-helix	886-894	9

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	205-207	3
α-helix	211-212	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transportin-1	A	protein	894	Homo sapiens	Q92973 (AlphaFold model)
Heterogeneous nuclear ribonucleoprotein H2, N-terminally processed	B	protein	126	Homo sapiens	P55795 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8SGH_1 Transportin-1 (chains A)
GGSKMEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTK
LKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITT
IASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMI
PKFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVC
RALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRH
LPKLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDEDGIEE
EDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKES
GILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDT
YLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHK
NLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATA
LQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLG
GNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKACFQHVKPCIADFMPILGTN
LNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTAITIG
RLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFC
DAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV

Sequence of entity 2 (B), FASTA

>8SGH_2 Heterogeneous nuclear ribonucleoprotein H2, N-terminally processed (chains B)
GGSNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQF
ASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGY
NSIGRG

Primary citation

A new Karyopherin-beta 2 binding PY-NLS epitope of HNRNPH2 linked to neurodevelopmental disorders. Gonzalez, A., Kim, H.J., Freibaum, B.D. et al. Structure (2023) 31:924-934.e4. DOI 10.1016/j.str.2023.05.010 · PubMed

Other PDB entries of the same protein (UniProt Q92973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FDD 2.3 Å, Crystal structure of KAP beta2-PY-NLS
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
4OO6 2.7 Å, Crystal structure of human KAP-beta2 bound to the NLS of HCC1 (Hepato Cellular Carcinoma…
7CYL 2.7 Å, Crystal structure of Karyopherin-beta2 in complex with FUS PY-NLS(P525L)
5YVI 2.9 Å, Crystal structure of Karyopherin beta2 in complex with FUS(456-526)
1QBK 3.0 Å, Structure of the karyopherin BETA2-ran gppnhp nuclear transport complex
2QMR 3.0 Å, Karyopherin beta2/transportin
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
4FQ3 3.0 Å, Crystal structure of transportin/FUS-NLS
5TQC 3.0 Å, Crystal structure of transport factor karyopherin-beta 2 in complex with the PY-NLS of…
2H4M 3.05 Å, Karyopherin Beta2/Transportin-M9NLS
4JLQ 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the PY-NLS of Saccharomyces…

Browse structure collections

About this viewer

MolViewer shows 8SGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.