6DMX: HBZ56
HBZ56 in complex with KIX and c-Myb. Determined by X-ray diffraction at 2.8 Å resolution. Released 19 Sept 2018.
- Method
- X-ray diffraction
- Resolution
- 2.8 Å
- Organisms
- Human T-lymphotropic virus 1, Mus musculus
- Chains
- 10
- Atoms
- 4,187
- Mol. weight
- 69.78 kDa
- Released
- 19 Sept 2018
Explore 6DMX in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6DMX contains 21 α-helices and 0 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, C and H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 291-303 | 13 | |
Chains B and G: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 590-594 | 5 | |
| α-helix | 597-611 | 15 | |
| α-helix | 623-642 | 20 | |
| α-helix | 646-671 | 26 | |
Chain D: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 592-594 | 3 | |
| α-helix | 597-611 | 15 | |
| α-helix | 623-642 | 20 | |
| α-helix | 646-670 | 25 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 16-55 | 40 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 290-303 | 14 | |
Chain I: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 597-611 | 15 | |
| α-helix | 623-642 | 20 | |
| α-helix | 646-670 | 25 | |
Chain J: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 18-53 | 36 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| BZIP factor | E, J | protein | 58 | Human T-lymphotropic virus 1 | P0C746 |
| Transcriptional activator Myb | A, C, F, H | protein | 32 | Mus musculus | P06876 (AlphaFold model) |
| CREB-binding protein | B, D, G, I | protein | 88 | Mus musculus | P45481 (AlphaFold model) |
Sequence of entity 1 (E, J), FASTA
>6DMX_1 BZIP factor (chains E, J)
GSHMASGLFRALPVSAPEDLLVEELVDGLLSLEEELKDKEEEKAVLDGLLSLEEESRG
Sequence of entity 2 (A, C, F, H), FASTA
>6DMX_2 Transcriptional activator Myb (chains A, C, F, H)
YNDEDPEKEKRIKELELLLMSTENELKGQQAL
Sequence of entity 3 (B, D, G, I), FASTA
>6DMX_3 CREB-binding protein (chains B, D, G, I)
MGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESAN
SRDEYYHLLAEKIYKIQKELEEKRRSRL
Primary citation
Structural basis for cooperative regulation of KIX-mediated transcription pathways by the HTLV-1 HBZ activation domain. Yang, K., Stanfield, R.L., Martinez-Yamout, M.A. et al. Proc Natl Acad Sci U S A (2018) 115:10040-10045. DOI 10.1073/pnas.1810397115 · PubMed
Browse structure collections
About this viewer
MolViewer shows 6DMX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.