6DNQ: HBZ77
HBZ77 in complex with KIX and c-Myb. Determined by X-ray diffraction at 2.35 Å resolution. Released 19 Sept 2018.
- Method
- X-ray diffraction
- Resolution
- 2.35 Å
- Organisms
- Human T-lymphotropic virus 1, Mus musculus
- Chains
- 5
- Atoms
- 2,297
- Mol. weight
- 37.38 kDa
- Released
- 19 Sept 2018
Explore 6DNQ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6DNQ contains 15 α-helices and 0 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 291-303 | 13 | |
Chain B: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 591-594 | 4 | |
| α-helix | 597-611 | 15 | |
| α-helix | 623-642 | 20 | |
| α-helix | 646-670 | 25 | |
Chain C: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 291-303 | 13 | |
| α-helix | 305-308 | 4 | |
Chain D: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 591-594 | 4 | |
| α-helix | 597-611 | 15 | |
| α-helix | 617-619 | 3 | |
| α-helix | 623-642 | 20 | |
| α-helix | 646-669 | 24 | |
Chain E: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-7 | 4 | |
| α-helix | 8-10 | 3 | |
| α-helix | 13-53 | 41 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| BZIP factor | E | protein | 79 | Human T-lymphotropic virus 1 | Q2Q067 |
| Transcriptional activator Myb | A, C | protein | 32 | Mus musculus | P06876 (AlphaFold model) |
| CREB-binding protein | B, D | protein | 88 | Mus musculus | P45481 (AlphaFold model) |
Sequence of entity 1 (E), FASTA
>6DNQ_1 BZIP factor (chains E)
GSHMASGLFRALPVSAPEDLLVEELVDGLLSLEEELKDKEEEKAVLDGLLSLEEESRGRL
RRGPPGEKAPPRGETHRDR
Sequence of entity 2 (A, C), FASTA
>6DNQ_2 Transcriptional activator Myb (chains A, C)
YNDEDPEKEKRIKELELLLMSTENELKGQQAL
Sequence of entity 3 (B, D), FASTA
>6DNQ_3 CREB-binding protein (chains B, D)
MGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESAN
SRDEYYHLLAEKIYKIQKELEEKRRSRL
Primary citation
Structural basis for cooperative regulation of KIX-mediated transcription pathways by the HTLV-1 HBZ activation domain. Yang, K., Stanfield, R.L., Martinez-Yamout, M.A. et al. Proc Natl Acad Sci U S A (2018) 115:10040-10045. DOI 10.1073/pnas.1810397115 · PubMed
Browse structure collections
About this viewer
MolViewer shows 6DNQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.