6DRD: RNA Pol II(G)
RNA Pol II(G). Determined by electron microscopy at 3.9 Å resolution. Released 12 Jun 2019.
- Method
- Electron microscopy
- Resolution
- 3.9 Å
- Organism
- Homo sapiens
- Chains
- 13
- Atoms
- 26,708
- Mol. weight
- 523.57 kDa
- Ligands
- ZN
- Released
- 12 Jun 2019
Explore 6DRD in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6DRD contains 138 α-helices and 196 β-strands across 13 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 53 helices, 48 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 365 | 1 | 1 |
| β-strand | 367-369 | 3 | 2 |
| β-strand | 378-379 | 2 | 2 |
| β-strand | 390-393 | 4 | 3 |
| α-helix | 394 | 1 | |
| α-helix | 398-400 | 3 | |
| α-helix | 402-408 | 7 | |
| β-strand | 416-420 | 5 | 3 |
| β-strand | 427-428 | 2 | 3 |
| α-helix | 435-437 | 3 | |
| β-strand | 445-448 | 4 | 3 |
| β-strand | 457 | 1 | 4 |
| β-strand | 471 | 1 | 4 |
| β-strand | 474-475 | 2 | 2 |
| β-strand | 482-484 | 3 | 2 |
| β-strand | 501 | 1 | 1 |
| β-strand | 504 | 1 | 4 |
| α-helix | 513-516 | 4 | |
| β-strand | 520 | 1 | 4 |
| α-helix | 539-548 | 10 | |
| β-strand | 554-555 | 2 | 5 |
| α-helix | 560-563 | 4 | |
| α-helix | 574-576 | 3 | |
| α-helix | 585 | 1 | |
| β-strand | 586-587 | 2 | 5 |
| α-helix | 588-595 | 8 | |
| β-strand | 602-604 | 3 | 6 |
| α-helix | 611-614 | 4 | |
| β-strand | 628-631 | 4 | 6 |
| β-strand | 634-637 | 4 | 6 |
| α-helix | 652-655 | 4 | |
| α-helix | 663-675 | 13 | |
| α-helix | 680-683 | 4 | |
| α-helix | 689-692 | 4 | |
| α-helix | 696-699 | 4 | |
| α-helix | 701-709 | 9 | |
| α-helix | 711-720 | 10 | |
| α-helix | 726-728 | 3 | |
| α-helix | 735-741 | 7 | |
| α-helix | 748-759 | 12 | |
| α-helix | 767-769 | 3 | |
| α-helix | 782-785 | 4 | |
| β-strand | 789 | 1 | 7 |
| β-strand | 793 | 1 | 8 |
| β-strand | 796 | 1 | 8 |
| β-strand | 823 | 1 | 7 |
| α-helix | 835-852 | 18 | |
| α-helix | 857-867 | 11 | |
| β-strand | 872-873 | 2 | 9 |
| β-strand | 879-880 | 2 | 9 |
| β-strand | 886-888 | 3 | 9 |
| α-helix | 891-893 | 3 | |
| β-strand | 896 | 1 | 10 |
| β-strand | 902-905 | 4 | 11 |
| α-helix | 913-919 | 7 | |
| α-helix | 929-933 | 5 | |
| α-helix | 941-944 | 4 | |
| α-helix | 946-949 | 4 | |
| α-helix | 952-969 | 18 | |
| β-strand | 976-979 | 4 | 11 |
| α-helix | 985-990 | 6 | |
| α-helix | 1006-1017 | 12 | |
| α-helix | 1028-1035 | 8 | |
| α-helix | 1040-1047 | 8 | |
| α-helix | 1054-1058 | 5 | |
| α-helix | 1062-1079 | 18 | |
| β-strand | 1080 | 1 | 10 |
| α-helix | 1087-1092 | 6 | |
| α-helix | 1121-1124 | 4 | |
| β-strand | 1139-1141 | 3 | 12 |
| β-strand | 1143 | 1 | 13 |
| α-helix | 1146-1149 | 4 | |
| α-helix | 1155-1158 | 4 | |
| β-strand | 1164 | 1 | 14 |
| β-strand | 1172-1176 | 5 | 15 |
| α-helix | 1181-1183 | 3 | |
| α-helix | 1190-1198 | 9 | |
| β-strand | 1207 | 1 | 16 |
| β-strand | 1211-1215 | 5 | 15 |
| α-helix | 1219-1222 | 4 | |
| α-helix | 1228-1239 | 12 | |
| β-strand | 1244-1247 | 4 | 15 |
| β-strand | 1256-1260 | 5 | 15 |
| β-strand | 1262 | 1 | 16 |
| α-helix | 1281-1292 | 12 | |
| β-strand | 1299 | 1 | 14 |
| β-strand | 1310 | 1 | 17 |
| β-strand | 1319-1320 | 2 | 18 |
| β-strand | 1330-1331 | 2 | 18 |
| β-strand | 1335 | 1 | 17 |
| β-strand | 1336-1337 | 2 | 12 |
| α-helix | 1343-1348 | 6 | |
| β-strand | 1352 | 1 | 13 |
| β-strand | 1358-1359 | 2 | 12 |
| α-helix | 1362-1366 | 5 | |
| α-helix | 1379-1382 | 4 | |
| α-helix | 1387-1389 | 3 | |
| α-helix | 1395-1397 | 3 | |
| α-helix | 1402-1405 | 4 | |
| β-strand | 1472-1475 | 4 | 19 |
| α-helix | 1477-1481 | 5 | |
Chain B: 36 helices, 63 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-29 | 8 | |
| α-helix | 31-36 | 6 | |
| α-helix | 41-43 | 3 | |
| α-helix | 46-50 | 5 | |
| α-helix | 57-61 | 5 | |
| α-helix | 63-64 | 2 | |
| β-strand | 65 | 1 | 20 |
| β-strand | 83-92 | 10 | 20 |
| β-strand | 97-99 | 3 | 21 |
| β-strand | 105-107 | 3 | 21 |
| α-helix | 110-115 | 6 | |
| β-strand | 121-133 | 13 | 20 |
| β-strand | 139-153 | 15 | 20 |
| α-helix | 154-155 | 2 | |
| α-helix | 168-171 | 4 | |
| β-strand | 185-187 | 3 | 22 |
| β-strand | 190-193 | 4 | 22 |
| β-strand | 196-197 | 2 | 23 |
| β-strand | 199-200 | 2 | 24 |
| α-helix | 201-202 | 2 | |
| β-strand | 206-207 | 2 | 25 |
| β-strand | 219-220 | 2 | 25 |
| β-strand | 236-237 | 2 | 25 |
| β-strand | 238-239 | 2 | 26 |
| α-helix | 246-248 | 3 | |
| β-strand | 256-257 | 2 | 26 |
| α-helix | 269-274 | 6 | |
| α-helix | 295-305 | 11 | |
| α-helix | 314-322 | 9 | |
| α-helix | 332-345 | 14 | |
| α-helix | 358-376 | 19 | |
| α-helix | 381-384 | 4 | |
| α-helix | 388-390 | 3 | |
| β-strand | 391-392 | 2 | 24 |
| α-helix | 396-420 | 25 | |
| α-helix | 440-446 | 7 | |
| β-strand | 468-469 | 2 | 22 |
| α-helix | 476-480 | 5 | |
| β-strand | 484 | 1 | 27 |
| β-strand | 485-486 | 2 | 23 |
| α-helix | 503-505 | 3 | |
| β-strand | 509 | 1 | 28 |
| β-strand | 525 | 1 | 27 |
| β-strand | 526 | 1 | 28 |
| β-strand | 531 | 1 | 29 |
| α-helix | 539-545 | 7 | |
| α-helix | 553-555 | 3 | |
| β-strand | 566-567 | 2 | 30 |
| β-strand | 568-569 | 2 | 31 |
| β-strand | 572-573 | 2 | 31 |
| α-helix | 580-591 | 12 | |
| β-strand | 602-606 | 5 | 30 |
| β-strand | 611-615 | 5 | 30 |
| β-strand | 622-627 | 6 | 29 |
| β-strand | 628-629 | 2 | 32 |
| β-strand | 632-633 | 2 | 32 |
| α-helix | 637-643 | 7 | |
| β-strand | 662-666 | 5 | 29 |
| α-helix | 670-672 | 3 | |
| β-strand | 695-696 | 2 | 29 |
| β-strand | 717 | 1 | 33 |
| α-helix | 720-728 | 9 | |
| β-strand | 749-751 | 3 | 34 |
| β-strand | 755 | 1 | 35 |
| β-strand | 759-760 | 2 | 36 |
| β-strand | 775 | 1 | 35 |
| β-strand | 776-782 | 7 | 37 |
| β-strand | 794-795 | 2 | 37 |
| β-strand | 796-797 | 2 | 38 |
| α-helix | 798-801 | 4 | |
| β-strand | 808-810 | 3 | 34 |
| β-strand | 817 | 1 | 39 |
| β-strand | 827-829 | 3 | 40 |
| β-strand | 837 | 1 | 41 |
| α-helix | 854-855 | 2 | |
| β-strand | 858-859 | 2 | 39 |
| β-strand | 865-871 | 7 | 40 |
| β-strand | 889 | 1 | 41 |
| β-strand | 892-895 | 4 | 40 |
| α-helix | 897-899 | 3 | |
| β-strand | 903-911 | 9 | 39 |
| β-strand | 917-924 | 8 | 39 |
| β-strand | 925-927 | 3 | 34 |
| β-strand | 935-936 | 2 | 42 |
| β-strand | 943 | 1 | 42 |
| β-strand | 948-949 | 2 | 38 |
| α-helix | 955-956 | 2 | |
| β-strand | 965-967 | 3 | 37 |
| β-strand | 977 | 1 | 33 |
| α-helix | 980-989 | 10 | |
| β-strand | 997-998 | 2 | 36 |
| α-helix | 1012-1015 | 4 | |
| β-strand | 1025-1026 | 2 | 37 |
| β-strand | 1029 | 1 | 43 |
| α-helix | 1035 | 1 | |
| β-strand | 1036 | 1 | 43 |
| α-helix | 1037 | 1 | |
| β-strand | 1041-1048 | 8 | 37 |
| β-strand | 1049-1050 | 2 | 42 |
Chain C: 12 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-15 | 8 | 44 |
| β-strand | 18-24 | 7 | 44 |
| α-helix | 28-38 | 11 | |
| β-strand | 44-55 | 12 | 45 |
| α-helix | 61-70 | 10 | |
| β-strand | 73 | 1 | 46 |
| β-strand | 101-103 | 3 | 45 |
| β-strand | 106-107 | 2 | 47 |
| α-helix | 112 | 1 | |
| β-strand | 113-116 | 4 | 48 |
| α-helix | 117-119 | 3 | |
| β-strand | 121-122 | 2 | 45 |
| α-helix | 128 | 1 | |
| β-strand | 129 | 1 | 46 |
| α-helix | 146-148 | 3 | |
| β-strand | 149-153 | 5 | 48 |
| β-strand | 157-158 | 2 | 47 |
| β-strand | 159-168 | 10 | 45 |
| α-helix | 174-176 | 3 | |
| β-strand | 179 | 1 | 49 |
| β-strand | 186 | 1 | 44 |
| α-helix | 203-205 | 3 | |
| β-strand | 229 | 1 | 44 |
| β-strand | 232-234 | 3 | 44 |
| β-strand | 235 | 1 | 49 |
| α-helix | 243-249 | 7 | |
| α-helix | 253-256 | 4 | |
| α-helix | 260-267 | 8 | |
| α-helix | 268-270 | 3 | |
Chain D: 7 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 31 | 1 | 19 |
| α-helix | 38-49 | 12 | |
| α-helix | 59-70 | 12 | |
| α-helix | 77-88 | 12 | |
| α-helix | 94-98 | 5 | |
| α-helix | 99-103 | 5 | |
| α-helix | 108-114 | 7 | |
| α-helix | 124-134 | 11 | |
Chain E: 7 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-23 | 16 | |
| β-strand | 26 | 1 | 50 |
| β-strand | 61-62 | 2 | 51 |
| β-strand | 64 | 1 | 50 |
| β-strand | 72-74 | 3 | 51 |
| α-helix | 84-96 | 13 | |
| β-strand | 101-106 | 6 | 51 |
| α-helix | 114-116 | 3 | |
| α-helix | 117-120 | 4 | |
| β-strand | 127-131 | 5 | 51 |
| β-strand | 148-150 | 3 | 52 |
| α-helix | 151-152 | 2 | |
| α-helix | 153-162 | 10 | |
| β-strand | 172-173 | 2 | 52 |
| α-helix | 180-183 | 4 | |
| β-strand | 190-195 | 6 | 52 |
| β-strand | 203-209 | 7 | 52 |
Chain F: 2 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 56 | 1 | 53 |
| α-helix | 61-74 | 14 | |
| α-helix | 90-98 | 9 | |
| β-strand | 104-109 | 6 | 19 |
| β-strand | 115-119 | 5 | 19 |
| β-strand | 124 | 1 | 53 |
Chain G: 2 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-13 | 12 | 19 |
| α-helix | 24-33 | 10 | |
| β-strand | 39 | 1 | 54 |
| β-strand | 43 | 1 | 54 |
| β-strand | 44-54 | 11 | 19 |
| β-strand | 57-59 | 3 | 19 |
| α-helix | 60 | 1 | |
| β-strand | 66-77 | 12 | 19 |
| β-strand | 85-88 | 4 | 55 |
| β-strand | 92 | 1 | 56 |
| β-strand | 97 | 1 | 56 |
| β-strand | 99-101 | 3 | 57 |
| β-strand | 104-108 | 5 | 57 |
| β-strand | 118-120 | 3 | 58 |
| β-strand | 127-129 | 3 | 58 |
| β-strand | 136 | 1 | 58 |
| β-strand | 142-145 | 4 | 55 |
| β-strand | 151-152 | 2 | 59 |
| β-strand | 157-158 | 2 | 59 |
| β-strand | 159-161 | 3 | 57 |
| β-strand | 170 | 1 | 55 |
Chain H: 2 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-10 | 7 | 60 |
| β-strand | 11-14 | 4 | 61 |
| β-strand | 25 | 1 | 62 |
| β-strand | 28-31 | 4 | 61 |
| β-strand | 39-41 | 3 | 61 |
| β-strand | 44 | 1 | 62 |
| β-strand | 56-61 | 6 | 60 |
| α-helix | 69-71 | 3 | |
| β-strand | 91-100 | 10 | 60 |
| β-strand | 113-117 | 5 | 60 |
| β-strand | 118 | 1 | 63 |
| β-strand | 121 | 1 | 63 |
| β-strand | 123-124 | 2 | 61 |
| α-helix | 135-136 | 2 | |
| β-strand | 139-147 | 9 | 60 |
5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA-directed RNA polymerase II subunit RPB1 | A | protein | 1970 | Homo sapiens | P24928 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit RPB2 | B | protein | 1174 | Homo sapiens | P30876 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit RPB3 | C | protein | 275 | Homo sapiens | P19387 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit RPB4 | D | protein | 142 | Homo sapiens | O15514 (AlphaFold model) |
| DNA-directed RNA polymerases I, II, and III subunit RPABC1 | E | protein | 210 | Homo sapiens | P19388 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC2 | F | protein | 127 | Homo sapiens | P61218 |
| DNA-directed RNA polymerase II subunit RPB7 | G | protein | 172 | Homo sapiens | P62487 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC3 | H | protein | 150 | Homo sapiens | P52434 |
| DNA-directed RNA polymerase II subunit RPB9 | I | protein | 125 | Homo sapiens | P36954 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC5 | J | protein | 67 | Homo sapiens | P62875 |
| DNA-directed RNA polymerase II subunit RPB11-a | K | protein | 117 | Homo sapiens | P52435 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC4 | L | protein | 58 | Homo sapiens | P53803 |
1 more molecules are not listed.
Sequence of entity 1 (A), FASTA
>6DRD_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
Sequence of entity 2 (B), FASTA
>6DRD_2 DNA-directed RNA polymerase II subunit RPB2 (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
Sequence of entity 3 (C), FASTA
>6DRD_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
Sequence of entity 4 (D), FASTA
>6DRD_4 DNA-directed RNA polymerase II subunit RPB4 (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY
Sequence of entity 5 (E), FASTA
>6DRD_5 DNA-directed RNA polymerases I, II, and III subunit RPABC1 (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLEQELLINITEHELVPEHVVMTKEEVSELLARYKLRENQLPRIQAGDPVA
RYFGIRRGQVVKIIRPSETAGRYITYRLVQ
Sequence of entity 6 (F), FASTA
>6DRD_6 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD
Sequence of entity 7 (G), FASTA
>6DRD_7 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
Sequence of entity 8 (H), FASTA
>6DRD_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Sequence of entity 9 (I), FASTA
>6DRD_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE
Sequence of entity 10 (J), FASTA
>6DRD_10 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
Sequence of entity 11 (K), FASTA
>6DRD_11 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Sequence of entity 12 (L), FASTA
>6DRD_12 DNA-directed RNA polymerases I, II, and III subunit RPABC4 (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 5 |
Primary citation
Architecture of Pol II(G) and molecular mechanism of transcription regulation by Gdown1. Jishage, M., Yu, X., Shi, Y. et al. Nat Struct Mol Biol (2018) 25:859-867. DOI 10.1038/s41594-018-0118-5 · PubMed
Other PDB entries of the same protein (UniProt P24928 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6G0R 1.25 Å, Crystal Structure of the first bromodomain of human BRD4 in complex with an acetylated…
- 7Z1K 1.55 Å, Crystal structure of the SPOC domain of human SHARP (SPEN) in complex with RNA…
- 3D9N 1.6 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
- 6XKB 1.6 Å, Crystal structure of SR-related and CTD-associated factor 4(SCAF4-CID)with peptide…
- 6IC9 1.75 Å, Crystal structure of the SPOC domain of human PHF3 in complex with RNA polymerase II CTD…
- 3D9M 1.75 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
- 2GHT 1.8 Å, CTD-specific phosphatase Scp1 in complex with peptide from C-terminal domain of RNA…
- 4JXT 1.9 Å, CID of human RPRD1A in complex with a phosphorylated peptide from RPB1-CTD
- 6IC8 1.93 Å, Crystal structure of the SPOC domain of human PHF3 in complex with RNA polymerase II CTD…
- 3D9O 2.0 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
- 2GHQ 2.05 Å, CTD-specific phosphatase Scp1 in complex with peptide C-terminal domain of RNA…
- 3D9P 2.1 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
Browse structure collections
About this viewer
MolViewer shows 6DRD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.