6DW0: Gamma-aminobutyric acid receptor subunit gamma-2

Cryo-EM structure of the benzodiazepine-sensitive alpha1beta1gamma2S tri-heteromeric GABAA receptor in complex with GABA (Whole map). Determined by electron microscopy at 3.8 Å resolution. Released 8 Aug 2018.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Rattus norvegicus
Chains: 5
Atoms: 11,929
Mol. weight: 242.41 kDa
Ligands: ABU
Released: 8 Aug 2018

Explore 6DW0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6DW0 contains 45 α-helices and 84 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	14-22	9
α-helix	36-37	2
β-strand	38-48	11	10
β-strand	49	1	11
α-helix	50-52	3
β-strand	53	1	12
β-strand	58	1	12
β-strand	61-70	10	10
α-helix	72-74	3
β-strand	83-85	3	10
α-helix	87-90	4
β-strand	98-100	3	13
β-strand	103-108	6	10
β-strand	110	1	14
β-strand	114	1	14
β-strand	116-120	5	10
β-strand	125-136	12	10
β-strand	137	1	12
β-strand	149-153	5	13
β-strand	156-158	3	13
β-strand	166-170	5	10
α-helix	174-177	4
β-strand	181	1	10
β-strand	185	1	11
β-strand	190-203	14	13
β-strand	208-220	13	13
α-helix	226-239	14
α-helix	242-245	4
α-helix	251-275	25
α-helix	277-278	2
α-helix	282-283	2
α-helix	284-306	23

Chain B: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	11-20	10
α-helix	35	1
β-strand	36-47	12	18
β-strand	51	1	18
β-strand	56-68	13	18
β-strand	81-83	3	18
α-helix	85-89	5
β-strand	97-98	2	19
β-strand	101-106	6	18
β-strand	114-118	5	18
β-strand	123-135	13	18
β-strand	150	1	19
β-strand	153-155	3	19
β-strand	164-168	5	18
α-helix	171-174	4
β-strand	175-176	2	18
β-strand	186-199	14	19
β-strand	204-216	13	19
α-helix	218-241	24
α-helix	247-255	9
α-helix	257-271	15
α-helix	280-301	22
α-helix	321-344	24

Chain C: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	13-20	8
α-helix	36-37	2
β-strand	38-53	16	4
β-strand	58-69	12	4
β-strand	70	1	5
α-helix	72-74	3
β-strand	82-85	4	6
α-helix	87-91	5
β-strand	99-100	2	7
β-strand	103	1	4
β-strand	107-108	2	4
β-strand	110	1	8
β-strand	114	1	8
β-strand	116	1	4
β-strand	118-121	4	6
β-strand	125	1	5
β-strand	128-137	10	4
β-strand	149-157	9	7
β-strand	166-170	5	4
α-helix	174-176	3
β-strand	178-179	2	4
β-strand	185	1	4
β-strand	190-198	9	7
β-strand	201-203	3	9
β-strand	208-210	3	9
β-strand	211-220	10	7
α-helix	223-243	21
α-helix	252-273	22
α-helix	284-306	23

Chain D: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	26-33	8
β-strand	52-65	14	1
β-strand	71-82	12	1
β-strand	95-98	4	1
β-strand	112-113	2	2
β-strand	116	1	1
α-helix	120	1
β-strand	121	1	1
α-helix	122	1
β-strand	130-134	5	1
β-strand	139-150	12	1
β-strand	163	1	3
β-strand	167	1	3
β-strand	169-170	2	2
β-strand	180-182	3	1
β-strand	191-192	2	1
β-strand	202-214	13	3
β-strand	219-230	12	3
α-helix	234-256	23
α-helix	262-283	22
α-helix	297-319	23

Chain E: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	11-20	10
α-helix	28	1
α-helix	35	1
β-strand	36-41	6	15
β-strand	42-43	2	16
β-strand	44-51	8	15
β-strand	56-68	13	15
α-helix	70-72	3
β-strand	81-83	3	15
α-helix	85-90	6
β-strand	96-98	3	17
β-strand	101-106	6	15
β-strand	114-118	5	15
β-strand	123-135	13	15
β-strand	150-156	7	17
β-strand	164-168	5	15
α-helix	171-174	4
β-strand	175-176	2	16
β-strand	186-199	14	17
β-strand	204-216	13	17
α-helix	218-241	24
α-helix	247-271	25
α-helix	281-301	21
α-helix	321-344	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit gamma-2	D	protein	490	Rattus norvegicus	P18508 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1	A, C	protein	402	Rattus norvegicus	P62813 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-1,Gamma-aminobutyric acid receptor subunit beta-1	B, E	protein	384	Rattus norvegicus	P15431 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>6DW0_1 Gamma-aminobutyric acid receptor subunit gamma-2 (chains D)
MSSPNTWSTGSTVYSPVFSQKMTLWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKV
PEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTW
YDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYT
LRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFS
FVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAV
PARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVS
NRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCF
EDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYLLVPRGSRHHHHHHH
HTETSQVAPA

Sequence of entity 2 (A, C), FASTA

>6DW0_2 Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, C)
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGTKKTFNSVSKIDRLSRIAFP
LLFGIFNLVYWATYLNREPQLKAPTPHQLVPRGSHHHHHHHH

Sequence of entity 3 (B, E), FASTA

>6DW0_3 Gamma-aminobutyric acid receptor subunit beta-1,Gamma-aminobutyric acid receptor subunit beta-1 (chains B, E)
MWTVQNRESLGLLSFPVMVAMVCCAHSSNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPP
VDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLK
RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKI
PYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGGTIPDLTDVNSIDKWSRMFFPITFSLF
NVVYWLYYVHLVPRGSHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	3

Primary citation

Cryo-EM structure of the benzodiazepine-sensitive alpha 1 beta 1 gamma 2S tri-heteromeric GABAAreceptor in complex with GABA. Phulera, S., Zhu, H., Yu, J. et al. Elife (2018) 7. DOI 10.7554/eLife.39383 · PubMed

Other PDB entries of the same protein (UniProt P18508 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PR9 2.51 Å, Mu2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with GABAA…
9OUN 2.74 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in…
9OUP 2.82 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in…
9OUR 2.84 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in…
9OUQ 2.89 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in…
9OUM 2.9 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in…
9OUO 2.92 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta1-alpha1-gamma2 subtype, in…
9OV4 2.93 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in…
6DW1 3.1 Å, Cryo-EM structure of the benzodiazepine-sensitive alpha1beta1gamma2S tri-heteromeric…

Browse structure collections

About this viewer

MolViewer shows 6DW0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.