6E2P: Human JAK2 FERM/SH2

Structure of human JAK2 FERM/SH2 in complex with Leptin Receptor. Determined by X-ray diffraction at 2.83 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 2.83 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,601
Mol. weight: 129.1 kDa
Released: 8 Aug 2018

Explore 6E2P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6E2P contains 38 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	39-43	5	1
β-strand	53-57	5	1
β-strand	62-63	2	2
α-helix	64-74	11
α-helix	82-84	3
β-strand	85-89	5	1
β-strand	95	1	1
α-helix	96-97	2
β-strand	101-102	2	2
β-strand	111-116	6	1
β-strand	131-134	4	3
β-strand	141-142	2	3
α-helix	147-162	16
α-helix	172-192	21
α-helix	197-201	5
α-helix	206-209	4
α-helix	212-218	7
α-helix	223-238	16
α-helix	247-261	15
α-helix	263-266	4
β-strand	268-274	7	4
β-strand	284-291	8	4
β-strand	295-300	6	4
α-helix	311-313	3
β-strand	315-318	4	4
α-helix	320-322	3
β-strand	323-328	6	4
β-strand	340-346	7	4
β-strand	352-356	5	4
α-helix	359-376	18
α-helix	385-387	3
α-helix	390-397	8
β-strand	401	1	5
α-helix	406-416	11
β-strand	422-427	6	5
β-strand	434-443	10	5
β-strand	446-456	11	5
β-strand	462-464	3	5
β-strand	471	1	5
α-helix	474-481	8
β-strand	486-488	3	6
β-strand	491-493	3	6
β-strand	497-498	2	5
β-strand	511-513	3	3

Chain B: 17 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	42-43	2	7
β-strand	53-54	2	7
β-strand	62-63	2	8
α-helix	64-75	12
α-helix	79-82	4
β-strand	85-89	5	7
β-strand	95-96	2	7
α-helix	97	1
β-strand	101-102	2	8
β-strand	112-116	5	7
β-strand	131-134	4	5
β-strand	141-142	2	5
α-helix	147-162	16
α-helix	172-192	21
α-helix	197-203	7
α-helix	206-209	4
α-helix	212-218	7
α-helix	223-238	16
α-helix	247-261	15
α-helix	263-266	4
β-strand	267-273	7	9
β-strand	285-291	7	9
β-strand	295-300	6	9
α-helix	308-310	3
β-strand	315-318	4	9
α-helix	320-322	3
β-strand	323-328	6	9
β-strand	340-346	7	9
β-strand	352-356	5	9
α-helix	361-376	16
α-helix	390-397	8
β-strand	401	1	10
α-helix	406-416	11
β-strand	423-427	5	10
β-strand	434-443	10	10
β-strand	446-456	11	10
β-strand	462-464	3	10
β-strand	470-471	2	10
α-helix	474-481	8
β-strand	485-486	2	11
β-strand	493-494	2	11
β-strand	498	1	10
β-strand	511-513	3	5

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	878-880	3

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	878-880	3
α-helix	882-884	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase JAK2	A, B	protein	484	Homo sapiens	O60674 (AlphaFold model)
Leptin receptor	C, D	protein	75	Homo sapiens	P48357 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6E2P_1 Tyrosine-protein kinase JAK2 (chains A, B)
GSDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIAASKACGITPVYHNMFALMSETER
IWYPPNHVFHIDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYL
FAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKENDQTPLAIYNSISYKTFLPKC
IRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKFEVK
EPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIKQANQ
EGSNESRVVTIHKQDGKNLEIELSSLREALSFVSLIDGYYRLTADAHHYLCKEVAPPAVL
ENIQSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCL
ITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFR
TGNS

Sequence of entity 2 (C, D), FASTA

>6E2P_2 Leptin receptor (chains C, D)
GSHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFIKHTASVTCGPLLLEPETISED
ISVDTSWKNKDEGNS

Primary citation

Receptor-mediated dimerization of JAK2 FERM domains is required for JAK2 activation. Ferrao, R.D., Wallweber, H., Lupardus, P.J. Elife (2018) 7. DOI 10.7554/eLife.38089 · PubMed

Other PDB entries of the same protein (UniProt O60674 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8BXH 1.3 Å, Crystal structure of JAK2 JH1 in complex with momelotinib
7LL4 1.31 Å, High-resolution crystal structure of human JAK2 kinase domain (JH1) bound to PN5-114.
3UGC 1.34 Å, Structural basis of Jak2 inhibition by the type II inhibtor NVP-BBT594
7REE 1.38 Å, High-resolution crystal structure of human JAK2 kinase domain (JH1) bound to YM2-059
8BA3 1.4 Å, Crystal structure of JAK2 JH2 in complex with Bemcentinib
8BX9 1.4 Å, Crystal structure of JAK2 JH1 in complex with ilginatinib
7TEU 1.45 Å, Crystal structure of JAK2 JH1 with type II inhibitor YLIU-04-105-1
9TM5 1.45 Å, Crystal structure of JAK2 JH1 in complex with AT9283
4IVA 1.5 Å, JAK2 kinase (JH1 domain) in complex with the inhibitor TRANS-4-[(8AS)-2-[(1R)-1-HYDROXYET…
7LL5 1.5 Å, High-resolution crystal structure of human JAK2 kinase domain (JH1) bound to PN5-150.
7RN6 1.5 Å, High-resolution crystal structure of human JAK2 kinase domain (JH1) bound to type-II…
8B8U 1.5 Å, Crystal structure of JAK2 JH2-V617F in complex with HTS-A3

Browse structure collections

About this viewer

MolViewer shows 6E2P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.