Legionella Longbeachae LeSH (Llo2327) bound to the human interleukin-2 receptor beta pTyr387 peptide. Determined by X-ray diffraction at 1.71 Å resolution. Released 14 Nov 2018.
Explore 6E8K in 3D Show helices and sheets RCSB PDB PDBe
6E8K contains 10 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-14 | 3 | |
| β-strand | 17 | 1 | 1 |
| α-helix | 22-31 | 10 | |
| α-helix | 34-36 | 3 | |
| β-strand | 43-47 | 5 | 1 |
| β-strand | 55-61 | 7 | 1 |
| β-strand | 66-75 | 10 | 1 |
| β-strand | 78-81 | 4 | 1 |
| α-helix | 82-83 | 2 | |
| α-helix | 85-89 | 5 | |
| α-helix | 95-124 | 30 | |
| α-helix | 131-141 | 11 | |
| α-helix | 146-148 | 3 | |
| β-strand | 149 | 1 | 1 |
| α-helix | 150-153 | 4 | |
| β-strand | 157 | 1 | 1 |
| α-helix | 161-163 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| LeSH (Llo2327) | A | protein | 169 | Legionella longbeachae serogroup 1 (strain NSW150) | D3HJY4 (AlphaFold model) |
| interleukin-2 receptor beta pTyr387 peptide | B | protein | 13 | Homo sapiens | P14784 (AlphaFold model) |
>6E8K_1 LeSH (Llo2327) (chains A) GAMEAMQKNELNSKIPIIFGLINSYQIHNLLEQHNAKTKESKAVFLIRDSSTYPGLLTIS YYCQEQDIVKHIRFGLTDKGWKTAPKPPHEPLKSDSPEIKEKYTLDKIKFERKMKQFINT AKKLFEQHIRAESFKTLIMELKIHEFNLEGLIKPTRSQASQEKHFTDYV
>6E8K_2 interleukin-2 receptor beta pTyr387 peptide (chains B) YFTYDPYSEEDPD
Identification and characterization of a large family of superbinding bacterial SH2 domains. Kaneko, T., Stogios, P.J., Ruan, X. et al. Nat Commun (2018) 9:4549-4549. DOI 10.1038/s41467-018-06943-2 · PubMed
Other PDB entries of the same protein (UniProt D3HJY4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6E8K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.