6EHR: Human LAMTOR-RagA CTD-RagC CTD complex
The crystal structure of the human LAMTOR-RagA CTD-RagC CTD complex. Determined by X-ray diffraction at 2.9 Å resolution. Released 4 Oct 2017.
- Method
- X-ray diffraction
- Resolution
- 2.9 Å
- Organism
- Homo sapiens
- Chains
- 7
- Atoms
- 6,126
- Mol. weight
- 97.14 kDa
- Released
- 4 Oct 2017
Explore 6EHR in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6EHR contains 34 α-helices and 32 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-11 | 8 | |
| α-helix | 13-15 | 3 | |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 33-36 | 4 | 1 |
| α-helix | 43-45 | 3 | |
| α-helix | 47-50 | 4 | |
| α-helix | 52-61 | 10 | |
| β-strand | 68-75 | 8 | 1 |
| β-strand | 78-85 | 8 | 1 |
| β-strand | 88-95 | 8 | 1 |
| α-helix | 100-109 | 10 | |
| α-helix | 111-121 | 11 | |
Chain B: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1-2 | 2 | 2 |
| α-helix | 4-12 | 9 | |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 31-36 | 6 | 1 |
| α-helix | 46-56 | 11 | |
| β-strand | 69-76 | 8 | 1 |
| β-strand | 80-86 | 7 | 1 |
| β-strand | 89-95 | 7 | 1 |
| α-helix | 101-123 | 23 | |
Chain C: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-13 | 11 | |
| β-strand | 18-24 | 7 | 3 |
| β-strand | 30-35 | 6 | 3 |
| α-helix | 39-41 | 3 | |
| α-helix | 42-52 | 11 | |
| α-helix | 53-55 | 3 | |
| β-strand | 64-68 | 5 | 3 |
| β-strand | 72-79 | 8 | 3 |
| β-strand | 82-89 | 8 | 3 |
Chain D: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-5 | 3 | |
| α-helix | 9-11 | 3 | |
| β-strand | 15-22 | 8 | 3 |
| β-strand | 25-29 | 5 | 3 |
| α-helix | 31-33 | 3 | |
| α-helix | 37-51 | 15 | |
| β-strand | 65-69 | 5 | 3 |
| β-strand | 73-80 | 8 | 3 |
| β-strand | 83-90 | 8 | 3 |
Chain E: 8 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 48-64 | 17 | |
| α-helix | 66-67 | 2 | |
| α-helix | 79-96 | 18 | |
| α-helix | 115-119 | 5 | |
| α-helix | 122-125 | 4 | |
| α-helix | 126-140 | 15 | |
| α-helix | 141-145 | 5 | |
| α-helix | 148-150 | 3 | |
| β-strand | 155-156 | 2 | 2 |
Chain F: 3 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 183-197 | 15 | |
| β-strand | 202-207 | 6 | 4 |
| β-strand | 213-218 | 6 | 4 |
| α-helix | 230-244 | 15 | |
| β-strand | 249-255 | 7 | 4 |
| β-strand | 260-265 | 6 | 4 |
| β-strand | 270-276 | 7 | 4 |
| α-helix | 283-297 | 15 | |
Chain G: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 240-252 | 13 | |
| β-strand | 256-263 | 8 | 4 |
| β-strand | 269-272 | 4 | 4 |
| α-helix | 281-295 | 15 | |
| α-helix | 296-300 | 5 | |
| β-strand | 315-320 | 6 | 4 |
| β-strand | 324-330 | 7 | 4 |
| β-strand | 335-342 | 8 | 4 |
| α-helix | 345-348 | 4 | |
| α-helix | 349-368 | 20 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Ragulator complex protein LAMTOR3 | A | protein | 127 | Homo sapiens | Q9UHA4 (AlphaFold model) |
| Ragulator complex protein LAMTOR2 | B | protein | 126 | Homo sapiens | Q9Y2Q5 (AlphaFold model) |
| Ragulator complex protein LAMTOR5 | C | protein | 91 | Homo sapiens | O43504 (AlphaFold model) |
| Ragulator complex protein LAMTOR4 | D | protein | 99 | Homo sapiens | Q0VGL1 (AlphaFold model) |
| Ragulator complex protein LAMTOR1 | E | protein | 145 | Homo sapiens | Q6IAA8 |
| Ras-related GTP-binding protein A | F | protein | 132 | Homo sapiens | Q7L523 |
| Ras-related GTP-binding protein C | G | protein | 163 | Homo sapiens | Q9HB90 |
Sequence of entity 1 (A), FASTA
>6EHR_1 Ragulator complex protein LAMTOR3 (chains A)
GAHMADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALAT
DQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEEL
RQVVEVS
Sequence of entity 2 (B), FASTA
>6EHR_2 Ragulator complex protein LAMTOR2 (chains B)
MGLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRN
GNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPL
TQVAAS
Sequence of entity 3 (C), FASTA
>6EHR_3 Ragulator complex protein LAMTOR5 (chains C)
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPT
DIPVVCLESDNGNIMIQKHDGITVAVHKMAS
Sequence of entity 4 (D), FASTA
>6EHR_4 Ragulator complex protein LAMTOR4 (chains D)
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMN
VPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
Sequence of entity 5 (E), FASTA
>6EHR_5 Ragulator complex protein LAMTOR1 (chains E)
SLMTLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGM
EQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIA
AYAYSALSQIRVDAKEELVVQFGIP
Sequence of entity 6 (F), FASTA
>6EHR_6 Ras-related GTP-binding protein A (chains F)
GNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKLS
CSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLE
RVDGPKHSLLMR
Sequence of entity 7 (G), FASTA
>6EHR_7 Ras-related GTP-binding protein C (chains G)
MGQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVS
CIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNF
HCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI
Primary citation
Crystal structure of the human lysosomal mTORC1 scaffold complex and its impact on signaling. de Araujo, M.E.G., Naschberger, A., Furnrohr, B.G. et al. Science (2017) 358:377-381. DOI 10.1126/science.aao1583 · PubMed
Other PDB entries of the same protein (UniProt Q9UHA4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6B9X 1.42 Å, Crystal structure of Ragulator
- 3CPT 1.9 Å, MP1-p14 Scaffolding complex
- 1SKO 2.0 Å, MP1-p14 Complex
- 2ZL1 2.0 Å, MP1-p14 Scaffolding complex
- 5X6V 2.02 Å, Crystal structure of human heteroheptameric complex
- 6EHP 2.3 Å, The crystal structure of the human LAMTOR complex
- 5X6U 2.4 Å, Crystal structure of human heteropentameric complex
- 5Y39 2.65 Å, Crystal structure of Ragulator complex (p18 76-145)
- 5Y3A 2.9 Å, Crystal structure of Ragulator complex (p18 49-161)
- 7UX2 2.9 Å, cryo-EM structure of the Raptor-TFEB-Rag-Ragulator complex
- 5YK3 3.01 Å, human Ragulator complex
- 6U62 3.18 Å, Raptor-Rag-Ragulator complex
Browse structure collections
About this viewer
MolViewer shows 6EHR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.