6EKV: OrfX2 from Clostridium botulinum A2

Structure of OrfX2 from Clostridium botulinum A2. Determined by X-ray diffraction at 2.1 Å resolution. Released 25 Oct 2017.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Clostridium botulinum (strain Kyoto / Type A2)
Chains: 1
Atoms: 5,820
Mol. weight: 86.31 kDa
Released: 25 Oct 2017

Explore 6EKV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EKV contains 22 α-helices and 44 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 44 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
α-helix	12-16	5
β-strand	33-39	7	2
β-strand	45-62	18	2
β-strand	65-80	16	2
β-strand	85-89	5	2
β-strand	94-98	5	2
β-strand	102-103	2	3
β-strand	109-110	2	3
β-strand	119-123	5	2
α-helix	132-148	17
α-helix	150-158	9
β-strand	164-167	4	1
β-strand	177-182	6	4
α-helix	183-193	11
β-strand	199-206	8	5
β-strand	209-217	9	5
β-strand	221-223	3	6
β-strand	231-236	6	6
β-strand	237-244	8	5
β-strand	247-250	4	5
β-strand	251	1	7
α-helix	252	1
β-strand	256-261	6	6
β-strand	263-268	6	8
β-strand	277	1	9
β-strand	282-288	7	8
β-strand	299-304	6	6
β-strand	307	1	7
α-helix	314-331	18
α-helix	332-334	3
β-strand	340-344	5	8
α-helix	346-347	2
β-strand	348	1	9
α-helix	351-356	6
β-strand	358-366	9	4
β-strand	369	1	10
β-strand	375	1	10
β-strand	381-388	8	4
α-helix	404-408	5
β-strand	412-417	6	4
α-helix	418-421	4
α-helix	422-426	5
α-helix	427-432	6
β-strand	441-444	4	11
β-strand	449-452	4	11
β-strand	456-462	7	11
β-strand	468-473	6	11
β-strand	478-483	6	11
β-strand	486-499	14	11
β-strand	502-519	18	11
β-strand	522-540	19	11
α-helix	541-564	24
α-helix	572-584	13
β-strand	586-589	4	11
β-strand	592-597	6	11
α-helix	599-609	11
α-helix	613-631	19
α-helix	642-650	9
α-helix	655-668	14
α-helix	671-674	4
α-helix	682-695	14
α-helix	705-712	8
β-strand	715-716	2	8
β-strand	725-731	7	4
β-strand	734-740	7	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Toxin complex component ORF-X2	A	protein	750	Clostridium botulinum (strain Kyoto / Type A2)	C1FUH4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6EKV_1 Toxin complex component ORF-X2 (chains A)
MNNLKPFIYYDWKKTILKNAKESYSINEIIPKTFFMELHGTKITNSTLNGTWKAWNLTDE
GEGSHPVLKCIIDDGYLDMNFGASSEKIPLKNVWIKLCMKINPNSDGTYSIPEKSSSFYI
KDNSLKISKDNLILDKYLNKLMLSYFKNNIKNIEMFINKSRIQTKVVGDLSLLGWNTENS
VSFRTMNEFIKKDNLYPKDFKAVYSYRKMTFTATGTFDSWEMTTGADGRNIRFKCPIKSA
AYDLDGDVFNSSTENFLLIQVDLTYFDSKTTINDPTGENDGKQFNLKVKTNDDKLKNVLI
VTYNLTDTDGSMSSEDKDFLSLAFRNWFNDNIQQFEQIFAYILLDETAKIPEYQWLKPTQ
ISYGSASVETANDEPDLDASIFSAMSMVENNTNSTPSHAVDNRMLQLTKTQAAFGISFPL
FIEHFLKQALLSSQFISVDDIVADINTLTITNNKQIIFGKVENSDGKNVDSSLKPGKLKL
SLQNNLIVLELFDLTWEQGRGVTGHFDFRQEYELTLESKSEKQIPILKVHDEPEIEYYVE
EAQWKANEDMIVSAVVGTVFSMILGAGMKLAGSALSKAGKLIRSKATTIKGRKKIYINRS
NVRQLRKDSGVTEMELQRINRRNSSIASEDARFISNNGTTSIQTLGDMKKKPMSTGQRIA
IGVKKITGTAVMFGAVGLGMNFGEMLINYINAMENNDYSAIPGINSFMQQCIGAMQWPDK
DSELKVTFGKLQGIYLLGGTLEKNNKPNSK

Primary citation

Crystal structures of OrfX2 and P47 from a Botulinum neurotoxin OrfX-type gene cluster. Gustafsson, R., Berntsson, R.P., Martinez-Carranza, M. et al. FEBS Lett (2017) 591:3781-3792. DOI 10.1002/1873-3468.12889 · PubMed

Other PDB entries of the same protein (UniProt C1FUH4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9ARL 4.0 Å, CryoEM structure of BoNT-NTNH-OrfX2 complex from Clostridium botulinum strain A1-ST7B,…
9ARK 4.1 Å, CryoEM structure of BoNT-NTNH-OrfX2 complex from Clostridium botulinum E1, minor class

Browse structure collections

About this viewer

MolViewer shows 6EKV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.