6ELR: Human jak1 kinase domain

Human jak1 kinase domain in complex with compound 7. Determined by X-ray diffraction at 1.8 Å resolution. Released 10 Oct 2018.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,088
Mol. weight: 70.37 kDa
Ligands: BFK
Released: 10 Oct 2018

Explore 6ELR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ELR contains 39 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	861-863	3
β-strand	869	1	1
α-helix	872-874	3
β-strand	875-882	8	1
β-strand	888-894	7	1
β-strand	903-909	7	1
α-helix	919-930	12
β-strand	937	1	2
α-helix	938-939	2
β-strand	940-945	6	1
β-strand	952-957	6	1
β-strand	963	1	2
α-helix	964-970	7
α-helix	977-996	20
β-strand	999-1000	2	3
α-helix	1006-1008	3
β-strand	1009-1013	5	2
β-strand	1016-1019	4	2
β-strand	1026-1027	2	3
α-helix	1028-1029	2
β-strand	1034-1036	3	4
α-helix	1045-1047	3
α-helix	1050-1055	6
β-strand	1057-1059	3	4
α-helix	1060-1075	16
α-helix	1080-1082	3
α-helix	1084-1092	9
α-helix	1097-1099	3
α-helix	1100-1109	10
α-helix	1114-1117	4
α-helix	1122-1130	9
α-helix	1136-1138	3
α-helix	1140-1141	2
α-helix	1142-1153	12

Chain B: 19 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	869	1	5
α-helix	872-874	3
β-strand	875-884	10	5
β-strand	887-894	8	5
β-strand	903-910	8	5
α-helix	919-930	12
β-strand	937	1	6
α-helix	938-939	2
β-strand	940-945	6	5
β-strand	952-957	6	5
β-strand	963	1	6
α-helix	964-970	7
α-helix	977-996	20
β-strand	999-1000	2	7
α-helix	1006-1008	3
β-strand	1009-1013	5	6
β-strand	1016-1019	4	6
β-strand	1026-1027	2	7
α-helix	1028-1029	2
β-strand	1034-1036	3	8
α-helix	1045-1047	3
α-helix	1050-1055	6
β-strand	1057-1059	3	8
α-helix	1060-1075	16
α-helix	1080-1082	3
α-helix	1084-1092	9
α-helix	1097-1099	3
α-helix	1100-1109	10
α-helix	1114-1117	4
α-helix	1122-1130	9
α-helix	1136-1138	3
α-helix	1140-1141	2
α-helix	1142-1153	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-Protein Kinase JAK1	A, B	protein	301	Homo sapiens	P23458 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6ELR_1 Tyrosine-Protein Kinase JAK1 (chains A, B)
DIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPE
SGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKN
KINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKE
YYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIG
PTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALL
K

Ligands and cofactors

ID	Name	Formula	Copies
BFK	[3-[[5-methyl-2-[[3-(4-methylpiperazin-1-yl)-5-methylsulfonyl-phenyl]amino]pyri…	C24 H30 N6 O3 S	2

Water and common crystallization additives (NA) are not listed.

Primary citation

Human jak1 kinase domain in complex with compound 7. grimster, N.P., read, J.A. To be published.

Other PDB entries of the same protein (UniProt P23458 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N7A 1.33 Å, Structure of the human JAK1 kinase domain with compound 39
10PI 1.54 Å, JAK1 kinase (JH1 domain) in complex with povorcitinib
6N77 1.64 Å, Structure of the human JAK1 kinase domain with compound 15
6N7C 1.69 Å, Structure of the human JAK1 kinase domain with compound 56
6GGH 1.7 Å, Human jak1 kinase domain in complex with inhibitor
6RSH 1.71 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
8S85 1.75 Å, Crystal structure of JAK1 JH1 domain in complex with an inhibitor
6RSD 1.76 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
6N7D 1.78 Å, Structure of the human JAK1 kinase domain with compound 54
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4L00 1.8 Å, Crystal structure of the apo Jak1 pseudokinase domain
6RSB 1.8 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…

Browse structure collections

About this viewer

MolViewer shows 6ELR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.