6ES7: Nuclear receptor coactivator 3

Structure and dynamics conspire in the evolution of affinity between intrinsically disordered proteins. Determined by solution NMR. Released 31 Oct 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 716
Mol. weight: 10.24 kDa
Released: 31 Oct 2018

Explore 6ES7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ES7 contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	1044-1056	13
α-helix	1061-1071	11
α-helix	1075-1078	4

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	2064-2075	12
α-helix	2081-2092	12
α-helix	2094-2102	9
α-helix	2104-2107	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor coactivator 3	A	protein	44	Homo sapiens	Q9Y6Q9 (AlphaFold model)
CREB-binding protein	B	protein	50	Homo sapiens	Q92793 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ES7_1 Nuclear receptor coactivator 3 (chains A)
GSEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQ

Sequence of entity 2 (B), FASTA

>6ES7_2 CREB-binding protein (chains B)
GSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYV

Primary citation

Structure and dynamics conspire in the evolution of affinity between intrinsically disordered proteins. Jemth, P., Karlsson, E., Vogeli, B. et al. Sci Adv (2018) 4:eaau4130-eaau4130. DOI 10.1126/sciadv.aau4130 · PubMed

Other PDB entries of the same protein (UniProt Q9Y6Q9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L3X 1.55 Å, Crystal structure of DHT-bound androgen receptor in complex with the first motif of…
9HFW 1.7 Å, SRC-3 (NCoA-3) peptide bound to SPOP MATH domain
3L3Z 2.0 Å, Crystal structure of DHT-bound androgen receptor in complex with the third motif of…
6SQC 2.28 Å, Crystal structure of complex between nuclear coactivator binding domain of CBP and…
1KBH Mutual Synergistic Folding in the Interaction Between Nuclear Receptor Coactivators CBP…

Browse structure collections

About this viewer

MolViewer shows 6ES7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.