Atomic resolution structure of RNase A (data collection 6). Determined by X-ray diffraction at 1.02 Å resolution. Released 21 Feb 2018.
Explore 6ETP in 3D Show helices and sheets RCSB PDB PDBe
6ETP contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-12 | 9 | |
| β-strand | 13 | 1 | 1 |
| α-helix | 25-32 | 8 | |
| β-strand | 43-47 | 5 | 1 |
| α-helix | 51-55 | 5 | |
| α-helix | 56-59 | 4 | |
| β-strand | 61-63 | 3 | 2 |
| β-strand | 72-74 | 3 | 2 |
| β-strand | 79-86 | 8 | 1 |
| β-strand | 91 | 1 | 3 |
| β-strand | 94 | 1 | 3 |
| β-strand | 97-104 | 8 | 1 |
| β-strand | 106-111 | 6 | 2 |
| β-strand | 116-123 | 8 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribonuclease pancreatic | A | protein | 124 | Bos taurus | P61823 (AlphaFold model) |
>6ETP_1 Ribonuclease pancreatic (chains A) KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQ KNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHF DASV
| ID | Name | Formula | Copies |
|---|---|---|---|
| IPA | Isopropyl alcohol | C3 H8 O | 4 |
Raman-markers of X-ray radiation damage of proteins. Vergara, A., Caterino, M., Merlino, A. Int J Biol Macromol (2018) 111:1194-1205. DOI 10.1016/j.ijbiomac.2018.01.135 · PubMed
Other PDB entries of the same protein (UniProt P61823 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6ETP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.