Crystal structure of ebolavirus glycoprotein in complex with bepridil. Determined by X-ray diffraction at 2.07 Å resolution. Released 3 Jan 2018.
Explore 6F5U in 3D Show helices and sheets RCSB PDB PDBe
6F5U contains 14 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-39 | 4 | 1 |
| β-strand | 42-45 | 4 | 1 |
| α-helix | 46-47 | 2 | |
| α-helix | 60-62 | 3 | |
| β-strand | 63-69 | 7 | 1 |
| α-helix | 70-73 | 4 | |
| α-helix | 79-83 | 5 | |
| β-strand | 86-89 | 4 | 2 |
| β-strand | 96-98 | 3 | 1 |
| β-strand | 101 | 1 | 1 |
| β-strand | 102-103 | 2 | 3 |
| β-strand | 105-114 | 10 | 4 |
| β-strand | 120 | 1 | 4 |
| α-helix | 123-126 | 4 | |
| β-strand | 135-144 | 10 | 4 |
| β-strand | 151-154 | 4 | 2 |
| β-strand | 159-161 | 3 | 1 |
| β-strand | 165-167 | 3 | 1 |
| β-strand | 169 | 1 | 2 |
| α-helix | 170-171 | 2 | |
| β-strand | 176 | 1 | 4 |
| β-strand | 177-185 | 9 | 1 |
| α-helix | 186-188 | 3 | |
| β-strand | 216-223 | 8 | 4 |
| β-strand | 231-235 | 5 | 4 |
| β-strand | 240-243 | 4 | 4 |
| α-helix | 250-262 | 13 | |
| β-strand | 273-275 | 3 | 4 |
| β-strand | 277 | 1 | 5 |
| β-strand | 308-310 | 3 | 5 |
| β-strand | 472-473 | 2 | 4 |
| β-strand | 474-476 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 503 | 1 | 1 |
| β-strand | 515-519 | 5 | 3 |
| α-helix | 539-541 | 3 | |
| β-strand | 544-548 | 5 | 3 |
| α-helix | 551-553 | 3 | |
| α-helix | 554-575 | 22 | |
| β-strand | 580-581 | 2 | 1 |
| α-helix | 584-597 | 14 | |
| α-helix | 613-619 | 7 | |
| α-helix | 620-625 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Envelope glycoprotein,Envelope glycoprotein,GP1 | A | protein | 330 | Zaire ebolavirus (strain Mayinga-76), Ebola virus | Q05320 (AlphaFold model) |
| Envelope glycoprotein | B | protein | 168 | Zaire ebolavirus (strain Mayinga-76) | Q05320 (AlphaFold model) |
>6F5U_1 Envelope glycoprotein,Envelope glycoprotein,GP1 (chains A) ETGRSIPLGVIHNSALQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWG FRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPC AGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATE DPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRS NTTGKLIWKVNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTVVSXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6F5U_2 Envelope glycoprotein (chains B) EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQL ANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPADWTKNITD KIDQIIHDFVDGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGTHHHHHH
Water and common crystallization additives (DMS, GOL) are not listed.
Target Identification and Mode of Action of Four Chemically Divergent Drugs against Ebolavirus Infection. Ren, J., Zhao, Y., Fry, E.E. et al. J Med Chem (2018) 61:724-733. DOI 10.1021/acs.jmedchem.7b01249 · PubMed
Other PDB entries of the same protein (UniProt Q05320 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6F5U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.