Crystal structure of Ebolavirus glycoprotein in complex with thioridazine. Determined by X-ray diffraction at 2.31 Å resolution. Released 23 May 2018.
Explore 6G95 in 3D Show helices and sheets RCSB PDB PDBe
6G95 contains 16 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-39 | 4 | 1 |
| β-strand | 42-45 | 4 | 1 |
| α-helix | 48-50 | 3 | |
| α-helix | 60-62 | 3 | |
| β-strand | 63-69 | 7 | 1 |
| α-helix | 70-73 | 4 | |
| α-helix | 79-83 | 5 | |
| β-strand | 86-89 | 4 | 2 |
| β-strand | 96-98 | 3 | 1 |
| β-strand | 101-103 | 3 | 1 |
| β-strand | 105-114 | 10 | 3 |
| β-strand | 120 | 1 | 3 |
| α-helix | 123 | 1 | |
| β-strand | 124 | 1 | 4 |
| α-helix | 125-126 | 2 | |
| β-strand | 135-144 | 10 | 3 |
| β-strand | 151-154 | 4 | 2 |
| β-strand | 159-161 | 3 | 1 |
| β-strand | 165-167 | 3 | 1 |
| β-strand | 169 | 1 | 2 |
| α-helix | 170-171 | 2 | |
| β-strand | 172 | 1 | 4 |
| β-strand | 176 | 1 | 3 |
| β-strand | 177-185 | 9 | 1 |
| α-helix | 186-187 | 2 | |
| β-strand | 216-223 | 8 | 3 |
| β-strand | 231-237 | 7 | 3 |
| β-strand | 240-243 | 4 | 3 |
| α-helix | 250-262 | 13 | |
| β-strand | 273-277 | 5 | 3 |
| α-helix | 290-292 | 3 | |
| β-strand | 308-310 | 3 | 3 |
| β-strand | 472-476 | 5 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 503 | 1 | 1 |
| β-strand | 515-519 | 5 | 1 |
| α-helix | 539-541 | 3 | |
| β-strand | 544-548 | 5 | 1 |
| α-helix | 551-553 | 3 | |
| α-helix | 554-575 | 22 | |
| β-strand | 580-581 | 2 | 1 |
| α-helix | 584-597 | 14 | |
| α-helix | 613-619 | 7 | |
| α-helix | 623-625 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Envelope glycoprotein | A | protein | 330 | Zaire ebolavirus (strain Mayinga-76) | Q05320 (AlphaFold model) |
| Envelope glycoprotein | B | protein | 168 | Zaire ebolavirus (strain Mayinga-76) | Q05320 (AlphaFold model) |
>6G95_1 Envelope glycoprotein (chains A) ETGRSIPLGVIHNSALQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWG FRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPC AGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATE DPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRS NTTGKLIWKVNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTVVXXXXXXXSTHHQDTGE ESASSGKLGLITNTIAGVAGLITGGRRTRR
>6G95_2 Envelope glycoprotein (chains B) EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQL ANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPADWTKNITD KIDQIIHDFVDGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGTHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| RTZ | 10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine | C21 H26 N2 S2 | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 4 |
Water and common crystallization additives (DMS, GOL) are not listed.
Structures of Ebola Virus Glycoprotein Complexes with Tricyclic Antidepressant and Antipsychotic Drugs. Zhao, Y., Ren, J., Fry, E.E. et al. J Med Chem (2018) 61:4938-4945. DOI 10.1021/acs.jmedchem.8b00350 · PubMed
Other PDB entries of the same protein (UniProt Q05320 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6G95 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.