6F7S: Serrate RNA effector molecule homolog

Crystal structure of Human ARS2 residues 147-270 + 408-763 with deletion of loop B. Determined by X-ray diffraction at 3.37 Å resolution. Released 9 May 2018.

Method: X-ray diffraction
Resolution: 3.37 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,149
Mol. weight: 106.48 kDa
Released: 9 May 2018

Explore 6F7S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6F7S contains 51 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	152-156	5
α-helix	166-190	25
α-helix	195-201	7
α-helix	203-230	28
β-strand	239	1	1
α-helix	240-242	3
α-helix	243-257	15
α-helix	264-268	5

Chain C: 20 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	412-414	3
β-strand	421-427	7	2
α-helix	433-441	9
β-strand	446-451	6	2
α-helix	452-454	3
β-strand	455	1	3
α-helix	456-458	3
β-strand	461	1	3
β-strand	462-468	7	2
α-helix	474-481	8
β-strand	485	1	4
β-strand	490	1	4
β-strand	493-496	4	2
α-helix	497-499	3
β-strand	503-506	4	1
α-helix	508-511	4
α-helix	513-534	22
α-helix	551-554	4
α-helix	561-565	5
α-helix	602-617	16
β-strand	621-622	2	5
β-strand	627-628	2	5
β-strand	642-645	4	1
α-helix	647-649	3
α-helix	655-669	15
α-helix	670-673	4
β-strand	678	1	6
α-helix	679-680	2
α-helix	681-687	7
α-helix	689-691	3
α-helix	692-702	11
β-strand	705-708	4	7
β-strand	711-713	3	7
β-strand	720-721	2	7
α-helix	724-734	11
α-helix	736-754	19
β-strand	755	1	6

Chain D: 17 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	421-427	7	9
α-helix	433-441	9
β-strand	446-451	6	9
α-helix	452-454	3
β-strand	455	1	10
α-helix	456-458	3
β-strand	461	1	10
β-strand	462-468	7	9
α-helix	474-481	8
β-strand	485	1	11
β-strand	490	1	11
β-strand	493-496	4	9
α-helix	497-499	3
β-strand	503-506	4	8
α-helix	508-511	4
α-helix	513-534	22
α-helix	601-617	17
β-strand	621-622	2	12
β-strand	627-628	2	12
β-strand	642-645	4	8
α-helix	647-649	3
α-helix	655-669	15
α-helix	670-673	4
β-strand	678	1	13
α-helix	679-680	2
α-helix	681-687	7
α-helix	689-691	3
α-helix	692-702	11
β-strand	705-708	4	14
β-strand	711-713	3	14
β-strand	720-721	2	14
α-helix	724-734	11
α-helix	736-754	19
β-strand	755	1	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serrate RNA effector molecule homolog	A, B	protein	124	Homo sapiens	Q9BXP5 (AlphaFold model)
Serrate RNA effector molecule homolog,Serrate RNA effector molecule homolog	C, D	protein	331	Homo sapiens	Q9BXP5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6F7S_1 Serrate RNA effector molecule homolog (chains A, B)
PVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEV
GKRRQEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLR
ILEQ

Sequence of entity 2 (C, D), FASTA

>6F7S_2 Serrate RNA effector molecule homolog,Serrate RNA effector molecule homolog (chains C, D)
GLECKPRPLHKTCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVT
FDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLI
HTLDDRTQLWASEPGTPPLPTSLPSQNPILKNITDYLIEEGSGSGSERDEKLIKVLDKLL
LYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGPMPPNRISHGEVLEWQKTFEEKLTPL
LSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIF
NKHAEKIEEVKKEVAFFNNFLTDAKRPALPE

Primary citation

Structural analysis of human ARS2 as a platform for co-transcriptional RNA sorting. Schulze, W.M., Stein, F., Rettel, M. et al. Nat Commun (2018) 9:1701-1701. DOI 10.1038/s41467-018-04142-7 · PubMed

Other PDB entries of the same protein (UniProt Q9BXP5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OO6 2.8 Å, Complex of human nuclear cap-binding complex with ARS2 C-terminal peptide
6F7J 3.22 Å, Crystal structure of Human ARS2 residues 171-270 + 408-763
8PMP 3.43 Å, Structure of the human nuclear cap-binding complex bound to ARS2[147-871] and m7GTP
6F8D 3.48 Å, Crystal structure of Human ARS2 residues 171-270 + 408-763 (P65 form)
6F7P 3.7 Å, Crystal structure of Human ARS2 residues 147-270 + 408-763

Browse structure collections

About this viewer

MolViewer shows 6F7S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.