Crystal structure of C-terminal modified Tau peptide-hybrid 4.2f-I with 14-3-3sigma. Determined by X-ray diffraction at 1.4 Å resolution. Released 16 May 2018.
Explore 6FAV in 3D Show helices and sheets RCSB PDB PDBe
6FAV contains 26 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-30 | 12 | |
| α-helix | 34-37 | 4 | |
| α-helix | 38-69 | 32 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 114-134 | 21 | |
| α-helix | 137-161 | 25 | |
| α-helix | 167-182 | 16 | |
| α-helix | 187-204 | 18 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-230 | 21 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-30 | 12 | |
| α-helix | 34-37 | 4 | |
| α-helix | 38-68 | 31 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 137-161 | 25 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-202 | 16 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-230 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein sigma | A, C | protein | 236 | Homo sapiens | P31947 (AlphaFold model) |
| Ace-arg-thr-pro-sep-leu-pro-gly | B | protein | 8 | Homo sapiens | P10636 (AlphaFold model) |
| Thr-pro-sep-leu-pro-gly | D | protein | 6 | Homo sapiens | P10636 (AlphaFold model) |
>6FAV_1 14-3-3 protein sigma (chains A, C) GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQ RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
>6FAV_2 ACE-ARG-THR-PRO-SEP-LEU-PRO-GLY (chains B) XRTPSLPG
>6FAV_3 THR-PRO-SEP-LEU-PRO-GLY (chains D) TPSLPG
| ID | Name | Formula | Copies |
|---|---|---|---|
| D3Q | (2~{R})-2-[(~{R})-(3-methoxyphenyl)-phenyl-methyl]pyrrolidine | C18 H21 N O | 2 |
Water and common crystallization additives (CL, NA) are not listed.
Inhibition of 14-3-3/Tau by Hybrid Small-Molecule Peptides Operating via Two Different Binding Modes. Andrei, S.A., Meijer, F.A., Neves, J.F. et al. ACS Chem Neurosci (2018) 9:2639-2654. DOI 10.1021/acschemneuro.8b00118 · PubMed
Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6FAV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.