6FF8: Uncomplexed Rab32 in the active GTP-bound state

Crystal structure of uncomplexed Rab32 in the active GTP-bound state at 2.13 Angstrom resolution. Determined by X-ray diffraction at 2.13 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 2.13 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,891
Mol. weight: 42.27 kDa
Ligands: MG, GTP
Released: 30 Jan 2019

Explore 6FF8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FF8 contains 15 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	22-32	11	1
α-helix	38-47	10
β-strand	60-70	11	1
β-strand	73-82	10	1
α-helix	84-88	5
α-helix	92-96	5
β-strand	101-107	7	1
α-helix	111-127	17
β-strand	129	1	2
β-strand	135	1	2
α-helix	136-137	2
β-strand	138-143	6	1
α-helix	155-165	11
β-strand	169-173	5	1
β-strand	174	1	3
β-strand	179	1	3
α-helix	181-197	17

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	22-32	11	4
α-helix	38-47	10
β-strand	60-70	11	4
β-strand	73-82	10	4
α-helix	86-88	3
α-helix	92-96	5
β-strand	101-107	7	4
α-helix	111-115	5
α-helix	117-127	11
α-helix	135-137	3
β-strand	138-143	6	4
α-helix	155-165	11
β-strand	169-173	5	4
β-strand	174	1	5
β-strand	179	1	5
α-helix	181-195	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-32	A, B	protein	181	Homo sapiens	Q13637 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6FF8_1 Ras-related protein Rab-32 (chains A, B)
SMETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRL
QLWDIAGLERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIP
AVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQ
S

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	2

Primary citation

LRRK2 binds to the Rab32 subfamily in a GTP-dependent mannerviaits armadillo domain. McGrath, E., Waschbusch, D., Baker, B.M. et al. Small GTPases (2019):1-14. DOI 10.1080/21541248.2019.1666623 · PubMed

Other PDB entries of the same protein (UniProt Q13637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OEC 2.3 Å, Human Rab32 (18-201):GDP in complex with Salmonella GtgE (21-214) C45A mutant
4CYM 2.8 Å, Complex of human VARP-ANKRD1 with Rab32-GppCp
5OED 2.9 Å, Human Rab32:GDP in complex with Salmonella GtgE C45A mutant
4CZ2 2.97 Å, Complex of human VARP-ANKRD1 with Rab32-GppCp. Selenomet derivative.

Browse structure collections

About this viewer

MolViewer shows 6FF8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.