6FHI: Polymerase acidic protein

Crystal structure of bat influenza A/H17N10 polymerase with viral RNA promoter bound to a 19-mer serine 5 phosphorylated Pol II CTD peptide with a truncated linker. Determined by X-ray diffraction at 2.8 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Influenza A virus, Homo sapiens
Chains: 6
Atoms: 18,364
Mol. weight: 278.8 kDa
Ligands: PO4, ZN
Released: 30 Jan 2019

Explore 6FHI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FHI contains 117 α-helices and 101 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-21	11
α-helix	36-49	14
β-strand	53-54	2	1
β-strand	60-61	2	1
β-strand	73-74	2	1
β-strand	76	1	2
α-helix	84-97	14
α-helix	106-107	2
β-strand	109-111	3	2
β-strand	116-118	3	2
α-helix	128-137	10
β-strand	143-144	2	2
β-strand	146-147	2	3
β-strand	155-156	2	3
α-helix	157-159	3
α-helix	165-184	20
α-helix	209-217	9
α-helix	226-235	10
α-helix	241-248	8
β-strand	258-259	2	4
α-helix	260	1
α-helix	265-271	7
β-strand	275	1	5
α-helix	276	1
β-strand	290-293	4	6
α-helix	303-311	9
β-strand	317-324	8	6
α-helix	331-347	17
β-strand	354-355	2	7
α-helix	356	1
α-helix	359-364	6
α-helix	371	1
β-strand	372-374	3	8
α-helix	376-379	4
β-strand	386-387	2	8
α-helix	391-395	5
β-strand	397	1	5
α-helix	401-409	9
β-strand	412	1	9
β-strand	415-416	2	6
α-helix	420-422	3
α-helix	424-426	3
α-helix	429-447	19
β-strand	448	1	9
α-helix	449-470	22
β-strand	475-476	2	7
β-strand	477-486	10	6
β-strand	491-501	11	6
α-helix	511	1
β-strand	512-521	10	6
α-helix	525-532	8
β-strand	536-545	10	6
β-strand	552-566	15	6
α-helix	567-574	8
α-helix	578-598	21
α-helix	603-608	6
β-strand	614-618	5	10
β-strand	623-626	4	10
α-helix	628-644	17
α-helix	648-668	21
β-strand	674-675	2	4
α-helix	678-686	9
α-helix	693-713	21

Chain B: 41 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	10
α-helix	5-10	6
α-helix	18-21	4
α-helix	27-29	3
α-helix	36-49	14
β-strand	54-57	4	11
β-strand	64-67	4	11
α-helix	72-74	3
α-helix	85-98	14
α-helix	102-116	15
β-strand	118	1	12
α-helix	119-123	5
β-strand	128-130	3	13
β-strand	135-137	3	13
α-helix	139-152	14
α-helix	157-160	4
β-strand	162	1	12
α-helix	163-172	10
β-strand	179-193	15	14
β-strand	198-212	15	14
α-helix	214-222	9
β-strand	223-224	2	15
β-strand	225-228	4	16
α-helix	229-230	2
β-strand	240-243	4	16
β-strand	245	1	13
α-helix	246-264	19
β-strand	269	1	4
α-helix	275-292	18
β-strand	298-305	8	4
β-strand	306	1	17
α-helix	309-312	4
α-helix	315-325	11
α-helix	331-337	7
α-helix	339-345	7
β-strand	348-350	3	15
β-strand	355-359	5	8
β-strand	364-368	5	8
α-helix	371-373	3
α-helix	383-393	11
β-strand	396	1	15
β-strand	400-402	3	15
α-helix	415-426	12
α-helix	429-432	4
β-strand	436-443	8	4
β-strand	446-453	8	4
α-helix	456-472	17
β-strand	477	1	17
β-strand	483-486	4	4
β-strand	489-492	4	18
β-strand	495-498	4	18
β-strand	501-502	2	18
α-helix	503	1
α-helix	505-511	7
α-helix	519-536	18
α-helix	541-558	18
α-helix	573-582	10
α-helix	586-588	3
α-helix	591-593	3
α-helix	595-597	3
α-helix	608-612	5
α-helix	613-615	3
α-helix	618-624	7
β-strand	642-644	3	19
β-strand	654-656	3	19
β-strand	667-668	2	20
α-helix	669-671	3
α-helix	673-676	4
α-helix	682-699	18
α-helix	701-704	4
β-strand	713	1	21
α-helix	714-731	18
α-helix	737-752	16

Chain C: 41 helices, 40 β-strands

Element	Residues	Length	Sheet
α-helix	1-12	12
α-helix	14-22	9
β-strand	24	1	21
α-helix	28-32	5
α-helix	38-40	3
α-helix	43-50	8
β-strand	57-59	3	20
α-helix	63-66	4
β-strand	70	1	22
β-strand	76	1	22
β-strand	78-82	5	20
α-helix	83	1
β-strand	89-91	3	20
α-helix	93-102	10
α-helix	111-114	4
α-helix	116-126	11
β-strand	129-135	7	23
β-strand	141-146	6	24
α-helix	156-167	12
α-helix	169-171	3
α-helix	180-192	13
α-helix	200-211	12
β-strand	215-220	6	24
α-helix	226-229	4
α-helix	232-235	4
β-strand	236	1	23
β-strand	240-245	6	23
α-helix	249-251	3
α-helix	252-271	20
α-helix	276-286	11
β-strand	287-289	3	25
β-strand	292-293	2	25
α-helix	294-300	7
α-helix	306-314	9
α-helix	317-319	3
β-strand	322-324	3	26
β-strand	329-335	7	26
β-strand	338-345	8	27
β-strand	351-358	8	27
β-strand	361-366	6	26
β-strand	370-377	8	26
β-strand	380-388	9	26
α-helix	391-404	14
α-helix	408-412	5
α-helix	427-429	3
α-helix	430-440	11
α-helix	443-449	7
β-strand	451-453	3	28
β-strand	460-461	2	26
β-strand	462-463	2	29
β-strand	469-470	2	29
β-strand	473-475	3	28
β-strand	478-481	4	26
β-strand	496-498	3	30
β-strand	504-506	3	30
β-strand	511-513	3	30
β-strand	529-531	3	25
α-helix	542-555	14
α-helix	557-565	9
α-helix	568-572	5
α-helix	575-577	3
α-helix	578-583	6
α-helix	588-605	18
α-helix	612-618	7
α-helix	619-622	4
α-helix	625-627	3
β-strand	635-640	6	31
β-strand	643-648	6	31
β-strand	657-659	3	32
β-strand	664-667	4	32
β-strand	670-671	2	32
α-helix	674-676	3
α-helix	677-681	5
β-strand	687	1	33
β-strand	694-699	6	33
α-helix	702-704	3
β-strand	708	1	33
α-helix	711-715	5
β-strand	721-727	7	33
β-strand	730-736	7	33
α-helix	740-741	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase acidic protein	A	protein	738	Influenza A virus	H6QM92
RNA-directed RNA polymerase catalytic subunit	B	protein	776	Influenza A virus	H6QM91
Polymerase basic protein 2	C	protein	809	Influenza A virus	H6QM90
RNA (5'-r(upapupapcpcpupcpupgpcpup*u)-3')	R	RNA	18	Influenza A virus
RNA (5'-r(papgpupapgpupapapcpapapgpapgpgpg)-3')	V	RNA	16	Influenza A virus
Tyr-ser-pro-thr-sep-pro-ser-tyr-ser-pro-ser-tyr-ser-pro-thr-sep-pro-ser-tyr	X	protein	19	Homo sapiens

Sequence of entity 1 (A), FASTA

>6FHI_1 Polymerase acidic protein (chains A)
GSHHHHHHHHGSGSMENFVRTNFNPMILERAEKTMKEYGENPQNEGNKFAAISTHMEVCF
MYSDFHFIDLEGNTIVKENDDDNAMLKHRFEIIEGQERNIAWTIVNSICNMTENSKPRFL
PDLYDYKTNKFIEIGVTRRKVEDYYYEKASKLKGENVYIHIFSFDGEEMATDDEYILDEE
SRARIKTRLFVLRQELATAGLWDSFRQSEKGEETLEEEFSYPPTFQRLANQSLPPSFKDY
HQFKAYVSSFKANGNIEAKLGAMSEKVNAQIESFDPRTIRELELPEGKFCTQRSKFLLMD
AMKLSVLNPAHEGEGIPMKDAKACLDTFWGWKKATIIKKHEKGVNTNYLMIWEQLLESIK
EMEGKFLNLKKTNHLKWGLGEGQAPEKMDFEDCKEVPDLFQYKSEPPEKRKLASWIQSEF
NKASELTNSNWIEFDELGNDVAPIEHIASRRRNFFTAEVSQCRASEYIMKAVYINTALLN
SSCTAMEEYQVIPIITKCRDTSGQRRTNLYGFIIKGRSHLRNDTDVVNFISLEFSLTDPR
NEIHKWEKYCVLEIGDMEIRTSISTIMKPVYLYVRTNGTSKIKMKWGMEMRRCLLQSLQQ
VESMIEAESAVKEKDMTEPFFRNRENDWPIGESPQGIEKGTIGKVCRVLLAKSVFNSIYA
SAQLEGFSAESRKLLLLIQAFRDNLDPGTFDLKGLYEAIEECIINDPWVLLNASWFNSFL
KAVQLSMGSGSGENLYFQ

Sequence of entity 2 (B), FASTA

>6FHI_2 RNA-directed RNA polymerase catalytic subunit (chains B)
GSGSGSGSGMDVNPMLIFLKVPVQNAISTTFPYTGDPPYSHGTGTGYTMDTVIRTHDYSS
RGIWKTNSETGAQQLNPIDGPLPEDNEPSGYAQTDCVLELIEGLDRSHPGLFETACQETI
DAIQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVFRKNGYKLNESGRLIDFLKDVL
LSFENDSMEVTTHFQKKKRIRDNHSKKMITQRTIGKKRVKLTKKNYLIRALTLNTMTKDA
ERGKLKRRAIATPGMQIRGFVYFVELLARNICERLEQSGLPVGGNEKKAKLANVIKKMMA
KSTDEELSYTITGDNTKWNENQNPRIFLAMVLRITAGQPEWFRDLLAVAPIMFSNKVARL
GRGYMFESKSMHLRTQISAENLSDINLRYFNEDTKKKIEKIRHLMVEGTASLSPGMMMGM
FNMLSTVLGVSVLNLGQREILKRTYWWDGLQSSDDFALIINGHFKEDIQQGVNHFYRTCK
LVGINMSQKKSYINKTGTFEFTSFFYRYGFVANFSMELPSFGVAGNNESADMSIGTTVIK
TNMINNDLGPATAQMAIQLFIKDYRYTYRCHRGDTNLETRRTKSIKRLWTETISKAGLLV
ADGGPNPYNLRNLHIPEVCLKWSLMDPDYRGRLCNPNNPFVHHMEVESTNLAVVMPAHGP
AKSLEYDAVATTHSWTPKRNRSILNTNQRGILEDERIYQKCCQVFEKFFPSSTYRRPIGM
ASMLDAMLSRARIDARIDLESGRISSQDFSEITNTCKAIEALKRQGSGSGENLYFQ

Sequence of entity 3 (C), FASTA

>6FHI_3 Polymerase basic protein 2 (chains C)
GSGSGSGSGMERIKELMEMVKNSRMREILTTTSVDHMAVIKKYTSGRQEKNPALRMKWMM
AMKYPISASSRIREMIPEKDEDGNTLWTNTKDAGSNRVLVSPNAVTWWNRAGPVSDVVHY
PRVYKMYFDRLERLTHGTFGPVKFYNQVKVRKRVDINPGHKDLTSREAQEVIMEVVFPNE
VGARTLSSDAQLTITKEKKEELKNCKISPIMVAYMLERELVRRTRFLPIAGATSSTYVEV
LHLTQGTCWEQQYTPGGEAENDDLDQTLIIASRNIVRRSIVAIDPLASLLSMCHTTSISS
EPLVEILRSNPTDEQAVNICKAALGIRINNSFSFGGYNFKRVKGSSQRTEKAVLTGNLQT
LTMTIFEGYEEFNVSGKRASAVLKKGAQRLIQAIIGGRTLEDILNLMITLMVFSQEEKML
KAVRGDLNFVNRANQRLNPMYQLLRHFQKDSSTLLKNWGTEEIDPIMGIAGIMPDGTINK
TQTLMGVRLSQGGVDEYSFNERIRVNIDKYLRVRNEKGELLISPEEVSEAQGQEKLPINY
NSSLMWEVNGPESILTNTYHWIIKNWELLKTQWMTDPTVLYNRIEFEPFQTLIPKGNRAI
YSGFTRTLFQQMRDVEGTFDSIQIIKLLPFSAHPPSLGRTQFSSFTLNIRGAPLRLLIRG
NSQVFNYNQMENVIIVLGKSVGSPERSILTESSSIESAVLRGFLILGKANSKYGPVLTIG
ELDKLGRGEKANVLIGQGDTVLVMKRKRDSSILTDSQTALKRIRLEESKGWSHPQFEKGG
GSGGGSGGSAWSHPQFEKGRSGGENLYFQ

Sequence of entity 4 (R), FASTA

>6FHI_4 RNA (5'-R(*UP*AP*UP*AP*CP*CP*UP*CP*UP*GP*CP*UP*U)-3') (chains R)
UAUACCUCUGCUUCUGCU

Sequence of entity 5 (V), FASTA

>6FHI_5 RNA (5'-R(P*AP*GP*UP*AP*GP*UP*AP*AP*CP*AP*AP*GP*AP*GP*GP*G)-3') (chains V)
AGUAGUAACAAGAGGG

Sequence of entity 6 (X), FASTA

>6FHI_6 TYR-SER-PRO-THR-SEP-PRO-SER-TYR-SER-PRO-SER-TYR-SER-PRO-THR-SEP-PRO-SER-TYR (chains X)
YSPTSPSYSPSYSPTSPSY

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	13
ZN	Zinc ion	Zn	1

Primary citation

Towards New Anti-Influenza Therapeutics: Structure-Activity Relationships in the Interaction between Heterotrimeric Influenza Polymerase and Pol II C-terminal domain. Claron, M., Lukarska, M., Uhrig, U. et al. To be published.

Other PDB entries of the same protein (UniProt H6QM92), best resolution first:

9F37 1.91 Å, Replication-like initiation state of influenza polymerase with GTP and CTP at…
9F2R 1.96 Å, Influenza A/H17N10 polymerase with bound promoter and 3' end of template in active site
6SZU 2.41 Å, Bat Influenza A polymerase pre-termination complex with pyrophosphate using 44-mer vRNA…
5M3H 2.5 Å, Bat influenza A/H17N10 polymerase bound to four heptad repeats of serine 5…
6SZV 2.5 Å, Bat Influenza A polymerase elongation complex with incoming UTP analogue (core +…
6T0N 2.54 Å, Bat Influenza A polymerase pre-initiation complex
4WSB 2.65 Å, Bat Influenza A polymerase with bound vRNA promoter
4NFZ 2.7 Å, Crystal structure of polymerase subunit PA N-terminal endonuclease domain from…
6FHH 2.7 Å, Crystal structure of bat influenza A/H17N10 polymerase with viral RNA promoter bound to…
6TW1 2.7 Å, Bat Influenza A polymerase termination complex with pyrophosphate using 44-mer vRNA…
6T0R 2.82 Å, Bat Influenza A polymerase product dissociation complex using 44-mer vRNA template with…
6EVK 2.9 Å, Crystal structure of bat influenza A/H17N10 polymerase with viral RNA promoter and cap…

Browse structure collections

About this viewer

MolViewer shows 6FHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.