6FHS: INO80core

CryoEM Structure of INO80core. Determined by electron microscopy at 3.75 Å resolution. Released 25 Apr 2018.

Method: Electron microscopy
Resolution: 3.75 Å
Organism: Chaetomium thermophilum var. thermophilum DSM 1495
Chains: 10
Atoms: 27,383
Mol. weight: 605.75 kDa
Ligands: ATP, ADP
Released: 25 Apr 2018

Explore 6FHS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FHS contains 173 α-helices and 201 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	1
β-strand	27	1	2
α-helix	32	1
β-strand	33	1	2
α-helix	34	1
β-strand	37	1	3
β-strand	40	1	3
α-helix	44-57	14
β-strand	66-69	4	4
α-helix	78-88	11
β-strand	94-97	4	4
α-helix	109-119	11
β-strand	121-129	9	5
β-strand	131-135	5	6
β-strand	136	1	7
β-strand	141-143	3	8
β-strand	155-158	4	8
β-strand	160-162	3	7
β-strand	169-171	3	7
β-strand	172	1	9
α-helix	175-182	8
β-strand	190-195	6	6
β-strand	201-206	6	6
β-strand	207	1	10
α-helix	208-210	3
β-strand	222	1	10
α-helix	224-226	3
β-strand	230	1	6
β-strand	233-240	8	5
α-helix	241-249	9
α-helix	258-261	4
α-helix	266-267	2
α-helix	274-289	16
β-strand	294-297	4	5
β-strand	299-302	4	4
α-helix	305-307	3
α-helix	310-320	11
α-helix	326	1
β-strand	327-331	5	4
β-strand	334	1	11
β-strand	336-338	3	12
β-strand	346-348	3	12
α-helix	355-358	4
β-strand	359-362	4	4
α-helix	363	1
α-helix	371-383	13
β-strand	387	1	13
α-helix	389-401	13
α-helix	404-407	4
α-helix	408-410	3
α-helix	412-420	9
β-strand	426	1	13
α-helix	428-437	10
β-strand	439	1	14
α-helix	442-451	10
β-strand	461	1	15

Chain B: 23 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	27	1	16
β-strand	33	1	16
β-strand	37	1	17
β-strand	40	1	17
α-helix	44-59	16
β-strand	66-69	4	18
α-helix	78-88	11
β-strand	94-98	5	18
α-helix	99-102	4
α-helix	112-120	9
β-strand	122-141	20	19
β-strand	158-163	6	19
β-strand	168	1	20
β-strand	172-173	2	19
α-helix	178-181	4
β-strand	190-195	6	19
β-strand	201-207	7	19
α-helix	208-210	3
β-strand	216	1	21
β-strand	221-222	2	19
α-helix	223-225	3
β-strand	230-240	11	19
α-helix	241-249	9
α-helix	257-260	4
α-helix	274-289	16
β-strand	293-296	4	19
β-strand	299-303	5	18
α-helix	310-319	10
α-helix	325-326	2
β-strand	327-331	5	18
β-strand	334	1	22
β-strand	337-338	2	23
α-helix	339	1
β-strand	346-347	2	23
α-helix	348-350	3
α-helix	353-356	4
β-strand	360-362	3	18
α-helix	369-371	3
α-helix	373-383	11
β-strand	387	1	24
α-helix	389-401	13
α-helix	404-407	4
α-helix	411-419	9
β-strand	426	1	24
α-helix	428-437	10
β-strand	439	1	25
α-helix	441-446	6
α-helix	447-451	5

Chain C: 20 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	5	1
β-strand	6	1	26
α-helix	7-8	2
β-strand	16	1	27
β-strand	27	1	28
β-strand	33	1	28
β-strand	37	1	29
β-strand	40	1	29
α-helix	44-58	15
β-strand	66-69	4	30
α-helix	77-88	12
β-strand	94	1	30
β-strand	98	1	30
α-helix	99-101	3
α-helix	112-120	9
β-strand	121-140	20	31
β-strand	143	1	32
α-helix	147-148	2
β-strand	154-155	2	32
β-strand	158-163	6	31
β-strand	168-173	6	31
α-helix	178-184	7
β-strand	190-194	5	31
β-strand	202-206	5	31
β-strand	221	1	31
β-strand	230-240	11	31
α-helix	241-249	9
α-helix	259-262	4
α-helix	274-290	17
β-strand	293-297	5	31
β-strand	299-303	5	30
α-helix	310-320	11
β-strand	327-331	5	30
β-strand	334	1	33
β-strand	336-338	3	34
β-strand	346-348	3	34
α-helix	356-358	3
β-strand	360-362	3	30
α-helix	365-368	4
α-helix	372-383	12
β-strand	387	1	35
α-helix	389-401	13
α-helix	404-407	4
α-helix	412-421	10
β-strand	426	1	35
α-helix	428-434	7
β-strand	439	1	36
α-helix	441-450	10
β-strand	461	1	37

Chain D: 15 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	38
β-strand	39	1	38
α-helix	51-65	15
β-strand	68	1	1
β-strand	72-76	5	14
α-helix	83-94	12
β-strand	100-104	5	14
α-helix	115-124	10
β-strand	127-137	11	39
β-strand	140-149	10	32
β-strand	156-163	8	32
β-strand	168-173	6	32
α-helix	175-184	10
β-strand	190-194	5	32
β-strand	195	1	39
β-strand	201-206	6	32
β-strand	223	1	32
β-strand	233-242	10	39
α-helix	243-251	9
α-helix	269-284	16
β-strand	288-292	5	39
β-strand	294-298	5	14
α-helix	300-302	3
α-helix	305-314	10
β-strand	322-326	5	14
β-strand	329	1	15
β-strand	331-333	3	40
α-helix	334	1
β-strand	340-342	3	40
β-strand	354-357	4	14
α-helix	363-376	14
α-helix	383-396	14
α-helix	398-414	17
α-helix	422-431	10
β-strand	433	1	30
α-helix	434	1
α-helix	435-444	10
β-strand	450	1	33

Chain E: 19 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	42-43	2	41
β-strand	46-47	2	41
α-helix	51-63	13
β-strand	72-76	5	25
α-helix	84-92	9
β-strand	100-104	5	25
α-helix	116-124	9
β-strand	127-137	11	42
β-strand	141-147	7	43
β-strand	158-163	6	43
β-strand	168-172	5	43
β-strand	173	1	21
α-helix	175-184	10
β-strand	190-191	2	43
β-strand	194	1	44
β-strand	201	1	44
β-strand	205-206	2	43
β-strand	207	1	45
α-helix	208-213	6
β-strand	224	1	45
α-helix	226-228	3
β-strand	233-242	10	42
α-helix	243-249	7
α-helix	258-261	4
α-helix	269-284	16
β-strand	290-292	3	42
β-strand	294-298	5	25
α-helix	300-302	3
β-strand	304	1	46
α-helix	305-314	10
α-helix	321	1
β-strand	322-327	6	25
β-strand	331-333	3	47
α-helix	334	1
β-strand	335	1	46
β-strand	340-342	3	47
α-helix	347-350	4
β-strand	354-357	4	25
α-helix	360-362	3
α-helix	363-377	15
β-strand	381	1	48
α-helix	383-414	32
β-strand	420	1	48
α-helix	422-431	10
β-strand	433	1	4
α-helix	435-443	9
β-strand	450	1	11

Chain F: 23 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	42-43	2	49
β-strand	46-47	2	49
α-helix	50-65	16
β-strand	68	1	27
β-strand	72-75	4	36
α-helix	83-92	10
β-strand	100-104	5	36
α-helix	105-107	3
α-helix	115-125	11
β-strand	127-148	22	26
β-strand	157-163	7	26
β-strand	168-173	6	26
α-helix	176-184	9
β-strand	190	1	50
β-strand	191-195	5	26
β-strand	201	1	26
β-strand	206-207	2	50
α-helix	208-210	3
β-strand	216	1	19
β-strand	223-224	2	50
α-helix	225-227	3
β-strand	232-242	11	26
α-helix	243-249	7
α-helix	255-257	3
α-helix	258-261	4
α-helix	269-284	16
β-strand	289-292	4	26
β-strand	294-298	5	36
α-helix	300-302	3
α-helix	305-314	10
β-strand	323-326	4	36
β-strand	329	1	37
β-strand	331-333	3	51
α-helix	334	1
β-strand	340-342	3	51
α-helix	347-350	4
β-strand	354-356	3	36
α-helix	360-362	3
α-helix	363-376	14
β-strand	381	1	52
α-helix	383-396	14
α-helix	398-401	4
α-helix	405-414	10
β-strand	420	1	52
α-helix	422-431	10
β-strand	433	1	18
α-helix	434	1
α-helix	435-444	10
β-strand	450	1	22

Chain G: 15 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1280	1	53
β-strand	1283-1284	2	54
β-strand	1287	1	55
β-strand	1302	1	9
β-strand	1308	1	55
β-strand	1312-1314	3	56
α-helix	1318-1322	5
α-helix	1335-1344	10
α-helix	1353-1356	4
α-helix	1366-1369	4
α-helix	1375-1381	7
α-helix	1387-1393	7
α-helix	1400-1406	7
α-helix	1418-1420	3
α-helix	1430-1434	5
α-helix	1448-1455	8
β-strand	1469-1470	2	54
α-helix	1472-1474	3
β-strand	1475-1477	3	56
α-helix	1481-1490	10
α-helix	1494-1501	8
α-helix	1505-1512	8
α-helix	1527-1530	4
β-strand	1541	1	53

Chain H: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	448-452	5	32
β-strand	457-460	4	32
α-helix	463-465	3
α-helix	471-474	4

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RuvB-like helicase	A, B, C	protein	462	Chaetomium thermophilum var. thermophilum DSM 1495	G0RYI5 (AlphaFold model)
RuvB-like helicase	D, E, F	protein	488	Chaetomium thermophilum var. thermophilum DSM 1495	G0RYC2 (AlphaFold model)
Ino80	G	protein	1107	Chaetomium thermophilum var. thermophilum DSM 1495
les2	H	protein	491	Chaetomium thermophilum var. thermophilum DSM 1495	G0RY01 (AlphaFold model)
les6	I	protein	219	Chaetomium thermophilum var. thermophilum DSM 1495	G0S590 (AlphaFold model)
Arp5	J	protein	769	Chaetomium thermophilum var. thermophilum DSM 1495	G0S589

Sequence of entity 1 (A, B, C), FASTA

>6FHS_1 RuvB-like helicase (chains A, B, C)
MVQISEVRGNTRDHRTAAHTHIKGLGLNSSGIAEKQAAGFVGQCAAREACGVVVDLIKAH
KMAGRGVLLAGGPGTGKTALALAISQELGTKIPFCPITGSEIYSTEVKKTEVLMENFRRA
IGLRVRETKDVYEGEVTEMTPEEAENPLGGYGKTISTLLIGLKSARGQKKLRLDPSIYEA
IQKERVQVGDVIYIETNTGACKRVGRSDAYATEFDLEAEEYVPIPKGEVHKKKEIVQDVT
LHDLDVANARPQGGQDIISMMGQLMKPKMTEITDKLRMEINKVVQKYINQGVAELIPGVL
FIDEAHMLDIECFTYLNKALESPIAPIVVLASNRGIATIRGADDLKAAHGIPPDFLQRLL
IIPTHPYEPDEIRRIVRIRAQTEGVQLTDAAVDRVAEHGVRISLRYCLQLLAPASILARV
NGRTQVDVQDIAEAEELFLDARRSANILTSTGESGGLHGFIS

Sequence of entity 2 (D, E, F), FASTA

>6FHS_2 RuvB-like helicase (chains D, E, F)
MAAPLVTSVTETKELRGLNLIAAHSHIRGLGVDADTLEPRPSSQGLVGQEKARKAAAVVL
EMIKQGKIAGRAVLIAGPPSTGKTAIAMGMAQSLGQDVPFTTLAASEIFSLEMSKTEALT
QAFRKSIGVRIKEESEIMEGEVVEIQIDRSVTGGAKQGKLTIKTTDMEAIYDMGSKMIDA
MTKERVMAGDIISIDKSSGKITKLGRSYARSRDYDAMGVDTKFLQCPEGELQKRKEVVHT
VSLHEIDVINSRTQGFLALFSGDTGEIRSEIRDQINTKVAEWKEEGKAEIVPGVLFIDEV
HMLDIECFSYINRALESDLAPIVIMASNRGVSRIRGTDYKSPHGLPLDFLDRVVIINTHP
YTPDELRQILSIRAQEEEVDLTPDALALLTKIGQEAGLRYASNLITTSQLIAAKRRAKQV
GVEDVQRSFKLFYDPARSVRFVQESEKRLIGNDGVVDFSYQGAAEAAAPTLPAAAPVDPV
GGEKMDMS

Sequence of entity 3 (G), FASTA

>6FHS_3 Ino80 (chains G)
MTDSYATKASNLKKTAILASKEAKRWQLRTNKGTKDLQARAKRVMRDMMGFWKRNEREER
DLRKAAERLELENARKEEADREAARQRRKLNFLISQTELYSHFISKKIKTHEVERSTDHP
DVATDEKDKIPEPTLNINVPEPTGPIAPKVTDFNSLDFDNEDESALQAAAMANAQNAIAE
AQKKAREFNKDETKLDEDGEMNFQHPELTEFEVAQPKLLNCQLKEYQLKGLNWLVNLYEQ
GINGILADEMGLGKTVQSISVMAYLAERYDIWGPFLVVAPASTLHNWQQEVSKFVPDFKV
LPYWGTAADRKVLRKFWDRKHTTYKKDSPFHVMITSYQLVVSDVAYFQKMKWQYMILDEA
QAIKSSQSSRWKCLLGFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSHDEFSEWFS
KDIESHAQSNTKLNEDQLKRLHMILKPFMLRRVKKHVQKELGDKIEIDVFCELSYRQRAM
YQSLRNQISIMDLIEKATVGDNEDSATLMNLVMQFRKVCNHPDLFERADTSSPFFCGHFA
ETGSFLREGTNVALGYSTRSLVEYRLPRLIWCDGGRLDKPGPGNLVAGFRSKYLNHMMNI
WTPENIRSSLEGIENFTWLRFVDTSLQEAYRASHTDVFARAVDLASKQNRLGHMQIVYDE
PEDKKWTPVHALFQICERENPKAVAEITTEGVLRDLMNIARVKYRELGLCRLEKAARPRA
SAPPIEVVCDSRSAVIERENIMFHPAMRKALFGPTPSEIKEASFGPRPVTLYPPRALLPA
PDHDKQRFTNITVPSMARFVTDSGKLAKLDELLRELKEGGHRVLLYFQMTRMIDLMEEYL
TYRNYKYCRLDGSTKLEDRRDTVADFQTRPEIFIFLLSTRAGGLGINLTTADTVIFYDSD
WNPTIDSQAMDRAHRLGQTKQVTVYRLITRGTIEERIRKRALQKEEVQRVVITGTGSVDF
SGRRPPENRNRDIAMWLADDEQAEMIERREKELIESGEYDKIMQQRRKGGKRKRGAANGD
TVPSLEDMYHEGEGHFDDNKGSGAATPVDADSLGRGGKRKKAGGSKKAKTTKQRLAIADG
EIDDGEIDIDYKDDDDKGTDYKDDDDK

Sequence of entity 4 (H), FASTA

>6FHS_4 les2 (chains H)
MSTRPRRHAAQRASQAITDLADRDRESDHSHGPISSRMSSFNSSSRSRLPGKGIASVSRS
EAGGASDPEHIHLTVKLPSSKLRQATSSSGIKKAGSVGSSSSSSGGGKAAVKRARGGKRS
RVLESSEEEEEENEVEVLGDEDEEEEEEEDEIEVREGEGYDEDEEDVEDEDEEMQDLGEE
DADGEDDEMDVDAEGEEDADGDVNMDAGVVGARATTVRAVPPAIKVTKPPKESPSNGKAA
TASKANDNAVPVKRPAPDSDDESLSSLESEPEEEVNVAGGEDAEGEDDDAEGEVDAEGEE
EEEEEEIEVADEDAEGEDVEQDEDEDEEEEDDDDEMISRAQTPDMSRLTARQRARLGEAS
GEYLKLSDEVQSKKHFTAEELSMRRAEMARRRRNLSEKRNEEIKMETVNKLLKKQAPRTT
RRAAQAAAAAEEAEEAAKQPKRPDPMMIRWVNNKMGSVVAVPEELLGTHAGVVFGAGPGK
GLPAGKMVEEV

Sequence of entity 5 (I), FASTA

>6FHS_5 les6 (chains I)
MSNPDAQSAQAAHQALVEQLDLHSIHKTFRNPNWRPNQRRNKTIKAILGESQRKEASSTS
AVATPRADDNGGGSGADTPANNDNNDGLSTSGTSTPANGNGSGAGTPASNGQPNLAQASR
SLQKLVLEKSLASAQAPDKKAANGFASSAPTATYTNIESAPSLAPMKHYCDVTGLPAPYL
DPKTRLRYHNKEIFAMIRNLPQGMGEQFLEARGAHTVLK

Sequence of entity 6 (J), FASTA

>6FHS_6 Arp5 (chains J)
MAPSAVAEPPPIPQRDEPWKRLPPPTVYPVKEARFEKYIPPQLDGRERALAQPPGQVAIV
IDNGSHSVRAGWNFEDKPRLAIPPIMSKYRDRKMGKTFSFAGSDCYADTTARSHIRNAFE
AGTGIVSNWDVMEHVLDYVFVKLGMNECDGAIDMPIVMTEAVANLPYSRKSMSEIIFECY
GAPSLVYGIDSLFSFRHNQGQTGLVVSSSYSATHVIPVYNRKALLSQAIRLNWGGWHMAE
YMLKLLKLKYYTGFPGKLNSSQTEHMVRDFCYVSLDYDRELAGYLDWTGLEDRERIVQYP
YTEEVVVQKTEEELARIAERKKESGRRLQEQAAKMRLERLMKKEQELEYYKDIQRRMQGE
SKKEIKRLLDEAELKDEAALERVIRDLERSIKRARQKDLGEPEEEEVPDFSLLDVPDDQL
DEAGLRQKRQQRLLKSNWEARQRAKAEKEAEKARLAEEARLDEERRKNDLEGWLEEKRQL
RLAKLNQLKERERLKADLGNRKSLASQIRMKNIANLASDNPTGSGSRKRRRGGAGADQDD
DFGADDADWGVYRSVAIGANKGDDSDDEEGEEDLEAAIRSLENDLLRYDKTFSYDMTLDA
QRDWSKSLLHAFRYGPRPFDPSSQAETHRVHLNVERIRVPEVLFQPAAIAGVDQAGLVEI
AGDILCQRLPSLPGIQDAPDAFLRDVFLTGGNTLFQNFDERLRQGLMALLPVGAPLRVRR
AQDAILDAWRGAAGWACTEEAKAAWITREEYLEKGGEYIKEHDLGNAFA

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	6

Primary citation

Structural basis for ATP-dependent chromatin remodelling by the INO80 complex. Eustermann, S., Schall, K., Kostrewa, D. et al. Nature (2018) 556:386-390. DOI 10.1038/s41586-018-0029-y · PubMed

Other PDB entries of the same protein (UniProt G0RYI5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OOP 2.7 Å, CryoEM Structure INO80core Hexasome complex composite model state2
8OO7 2.8 Å, CryoEM Structure INO80core Hexasome complex composite model state1
8OOR 2.87 Å, CryoEM Structure INO80core Hexasome complex Rvb core refinement state2
5FM7 2.9 Å, Double-heterohexameric rings of full-length Rvb1(ADP)Rvb2(ADP)
8OOC 2.93 Å, CryoEM Structure INO80core Hexasome complex Rvb core refinement state1
4WW4 2.94 Å, Double-heterohexameric rings of full-length Rvb1(ADP)/Rvb2(ADP)
5FM6 3.0 Å, Double-heterohexameric rings of full-length Rvb1(ADP)Rvb2(apo)
4WVY 3.64 Å, Double-heterohexameric rings of full-length Rvb1(ATP)/Rvb2(apo)
6FML 4.34 Å, CryoEM Structure INO80core Nucleosome complex
8AV6 4.68 Å, CryoEM structure of INO80 core nucleosome complex in closed grappler conformation

Browse structure collections

About this viewer

MolViewer shows 6FHS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.