6FNZ: Neuronal migration protein doublecortin

Crystal Structure of domain-swapped C-terminal domain of human doublecortin. Determined by X-ray diffraction at 2.23 Å resolution. Released 4 Apr 2018.

Method: X-ray diffraction
Resolution: 2.23 Å
Organisms: Homo sapiens, unidentified
Chains: 7
Atoms: 2,687
Mol. weight: 38.17 kDa
Released: 4 Apr 2018

Explore 6FNZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FNZ contains 14 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	261-267	7	1
β-strand	271	1	2
β-strand	276-280	5	1
α-helix	288-301	14
α-helix	304-306	3
β-strand	308-310	3	3
α-helix	315	1
β-strand	316-317	2	3
α-helix	320-323	4
β-strand	329-333	5	3

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	261-267	7	4
β-strand	271	1	5
β-strand	276-280	5	4
α-helix	288-302	15
β-strand	308-310	3	6
α-helix	315	1
β-strand	316-317	2	6
α-helix	320-323	4
β-strand	329-333	5	6

Chain C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	261-267	7	3
β-strand	271	1	2
β-strand	276-280	5	3
α-helix	288-302	15
α-helix	304-306	3
β-strand	308-311	4	1
β-strand	316-317	2	1
α-helix	320-323	4
β-strand	329-333	5	1

Chain D: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	261-267	7	6
β-strand	271	1	5
β-strand	276-280	5	6
α-helix	288-301	14
α-helix	304-306	3
β-strand	308-311	4	4
α-helix	315	1
β-strand	316-317	2	4
α-helix	320-324	5
β-strand	329-333	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuronal migration protein doublecortin	A, B, C, D	protein	81	Homo sapiens	O43602 (AlphaFold model)
possible peptide	E, F, G	protein	6	unidentified

Sequence of entity 1 (A, B, C, D), FASTA

>6FNZ_1 Neuronal migration protein doublecortin (chains A, B, C, D)
KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDG
KQVTCLHDFFGDDDVFIACGP

Sequence of entity 2 (E, F, G), FASTA

>6FNZ_2 possible peptide (chains E, F, G)
PESSEG

Primary citation

Domain swap in the C-terminal ubiquitin-like domain of human doublecortin. Rufer, A.C., Kusznir, E., Burger, D. et al. Acta Crystallogr D Struct Biol (2018) 74:450-462. DOI 10.1107/S2059798318004813 · PubMed

Other PDB entries of the same protein (UniProt O43602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IO9 1.3 Å, X-ray structure of the N-terminal domain of human doublecortin
5IP4 1.81 Å, X-ray structure of the C-terminal domain of human doublecortin
5IKC 2.06 Å, X-RAY STRUCTURE OF THE N-TERMINAL DOMAIN OF HUMAN DOUBLECORTIN in complex with FAB
2BQQ 2.2 Å, X-ray Structure of the N-terminal Domain of Human Doublecortin
5IOI 2.4 Å, X-ray structure of the N-terminal domain of human doublecortin
5IN7 2.48 Å, X-ray structure of the N-terminal domain of human doublecortin
6REV 3.8 Å, Cryo-EM structure of the N-terminal DC repeat (NDC) of human doublecortin (DCX) bound to…
6RF8 3.8 Å, Cryo-EM structure of the N-terminal DC repeat (NDC) of NDC-NDC chimera (human sequence)…
6RFD 3.9 Å, Cryo-EM structure of the N-terminal DC repeat (NDC) of NDC-NDC chimera (human sequence)…
6RF2 4.2 Å, Cryo-EM structure of the C-terminal DC repeat (CDC) of human doublecortin (DCX) bound to…
2XRP 8.2 Å, Human Doublecortin N-DC Repeat (1MJD) and Mammalian Tubulin (1JFF and 3HKE) Docked into…
4ATU 8.3 Å, Human doublecortin N-DC repeat plus linker, and tubulin (2XRP) docked into an 8A cryo-EM…

Browse structure collections

About this viewer

MolViewer shows 6FNZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.