6FPR: Signal recognition particle receptor FtsY

Co-translational folding intermediate dictates membrane targeting of the signal recognition particle (SRP)- receptor. Determined by X-ray diffraction at 2.65 Å resolution. Released 9 May 2018.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Escherichia coli (strain K12)
Chains: 2
Atoms: 854
Mol. weight: 13.86 kDa
Released: 9 May 2018

Explore 6FPR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FPR contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-51	45

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-60	53

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle receptor FtsY	A, B	protein	62	Escherichia coli (strain K12)	P10121 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6FPR_1 Signal recognition particle receptor FtsY (chains A, B)
GSKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEI
LA

Primary citation

Co-translational Folding Intermediate Dictates Membrane Targeting of the Signal Recognition Particle Receptor. Karniel, A., Mrusek, D., Steinchen, W. et al. J Mol Biol (2018) 430:1607-1620. DOI 10.1016/j.jmb.2018.04.017 · PubMed

Other PDB entries of the same protein (UniProt P10121 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N9B 1.22 Å, FtsY-NG ultra high-resolution
6N5J 1.37 Å, FtsY-NG high-resolution
6CQP 1.45 Å, High resolution crystal structure of FtsY-NG domain of E. coli
6N5I 1.5 Å, FtsY-NG high-resolution
6NC1 1.6 Å, FtsY-NG high-resolution
2YHS 1.6 Å, Structure of the E. coli SRP receptor FtsY
6NC4 1.6 Å, FtsY-NG high-resolution
5NIY 1.7 Å, Signal recognition particle-docking protein FtsY
6CS8 1.75 Å, High resolution crystal structure of FtsY-NG domain of E. coli
6CVD 1.78 Å, High resolution crystal structure of FtsY-NG domain of E. coli bound to fragment 1
6DLX 1.85 Å, FtsY-NG domain bound to fragment 3.
6N6N 1.88 Å, FtsY-NG high-resolution

Browse structure collections

About this viewer

MolViewer shows 6FPR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.