6FQD: Signal recognition particle receptor FtsY

Escherichia Coli Signal Recognition Particle Receptor FtsY NGdN1. Determined by X-ray diffraction at 2.1 Å resolution. Released 9 May 2018.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Escherichia coli (strain K12)
Chains: 2
Atoms: 4,483
Mol. weight: 63.43 kDa
Ligands: GDP
Released: 9 May 2018

Explore 6FQD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FQD contains 24 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	225-237	13
α-helix	242-255	14
α-helix	264-280	17
α-helix	284-286	3
β-strand	294-299	6	1
α-helix	306-319	14
β-strand	324-327	4	1
α-helix	334-346	13
β-strand	351-352	2	1
α-helix	360-373	14
β-strand	378-381	4	1
α-helix	393-407	15
β-strand	414-420	7	1
α-helix	421-423	3
α-helix	426-438	13
β-strand	442-446	5	1
α-helix	456-464	9
β-strand	468-472	5	1
β-strand	480-482	3	1
α-helix	485-493	9

Chain B: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	225-237	13
α-helix	242-255	14
α-helix	264-280	17
α-helix	284-286	3
β-strand	294-299	6	2
α-helix	306-319	14
β-strand	324-327	4	2
α-helix	334-346	13
β-strand	351-352	2	2
α-helix	360-373	14
β-strand	378-381	4	2
α-helix	393-407	15
β-strand	414-420	7	2
α-helix	421-423	3
α-helix	426-438	13
β-strand	442-446	5	2
α-helix	456-464	9
β-strand	468-472	5	2
β-strand	480-482	3	2
α-helix	485-492	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle receptor FtsY	A, B	protein	285	Escherichia coli (strain K12)	P10121 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6FQD_1 Signal recognition particle receptor FtsY (chains A, B)
MGHHHHHHKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLK
EEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTF
RAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSH
LMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTA
KGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFARED

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2

Water and common crystallization additives (K) are not listed.

Primary citation

Co-translational Folding Intermediate Dictates Membrane Targeting of the Signal Recognition Particle Receptor. Karniel, A., Mrusek, D., Steinchen, W. et al. J Mol Biol (2018) 430:1607-1620. DOI 10.1016/j.jmb.2018.04.017 · PubMed

Other PDB entries of the same protein (UniProt P10121 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N9B 1.22 Å, FtsY-NG ultra high-resolution
6N5J 1.37 Å, FtsY-NG high-resolution
6CQP 1.45 Å, High resolution crystal structure of FtsY-NG domain of E. coli
6N5I 1.5 Å, FtsY-NG high-resolution
6NC1 1.6 Å, FtsY-NG high-resolution
2YHS 1.6 Å, Structure of the E. coli SRP receptor FtsY
6NC4 1.6 Å, FtsY-NG high-resolution
5NIY 1.7 Å, Signal recognition particle-docking protein FtsY
6CS8 1.75 Å, High resolution crystal structure of FtsY-NG domain of E. coli
6CVD 1.78 Å, High resolution crystal structure of FtsY-NG domain of E. coli bound to fragment 1
6DLX 1.85 Å, FtsY-NG domain bound to fragment 3.
6N6N 1.88 Å, FtsY-NG high-resolution

Browse structure collections

About this viewer

MolViewer shows 6FQD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.