6FTY: Complement factor D

Complement factor D complexed with compound 5. Determined by X-ray diffraction at 1.67 Å resolution. Released 6 Jun 2018.

Method: X-ray diffraction
Resolution: 1.67 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,951
Mol. weight: 25.18 kDa
Ligands: E7H
Released: 6 Jun 2018

Explore 6FTY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FTY contains 9 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	39-48	10	3
β-strand	51-54	4	3
α-helix	56-59	4
β-strand	64-68	5	3
β-strand	72	1	4
β-strand	81-90	10	3
β-strand	104-108	5	3
β-strand	115	1	5
β-strand	120	1	5
α-helix	122-124	3
β-strand	124A	1	2
α-helix	129A-131	3
β-strand	135-140	6	2
α-helix	150-152	3
β-strand	154	1	4
β-strand	156-163	8	2
α-helix	164	1
α-helix	165-168	4
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-201	4	2
β-strand	208-213	6	2
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-242	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement factor D	A	protein	232	Homo sapiens	P00746 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6FTY_1 Complement factor D (chains A)
ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSL
SQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPG
TLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCK
GDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLASAAA

Ligands and cofactors

ID	Name	Formula	Copies
E7H	4-[[(5~{S},7~{R})-3-azanyl-1-adamantyl]carbonylamino]-1~{H}-indole-2-carboxamide	C20 H24 N4 O2	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Discovery and Design of First Benzylamine-Based Ligands Binding to an Unlocked Conformation of the Complement Factor D. Vulpetti, A., Ostermann, N., Randl, S. et al. ACS Med Chem Lett (2018) 9:490-495. DOI 10.1021/acsmedchemlett.8b00104 · PubMed

Other PDB entries of the same protein (UniProt P00746 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NAT 1.17 Å, Complement factor D in complex with the inhibitor (S)-Pyrrolidine-1,2-dicarboxylic acid…
2XW9 1.2 Å, Crystal Structure of Complement Factor D mutant S183A
5NAW 1.25 Å, Complement factor D in complex with the inhibitor (1R,3S,5R)-2-Aza-bicyclo[3.1.0]hexane-2…
5MT0 1.29 Å, Complement factor D in complex with a reversible indole carboxylic acid based inhibitor
5NB7 1.33 Å, Complement factor D
6FUH 1.37 Å, Complement factor D in complex with the inhibitor (4-((3-(aminomethyl)phenyl)amino)quinaz…
6FUI 1.38 Å, Complement factor D in complex with the inhibitor 3-((3-((3-(aminomethyl)phenyl)amino)-1H…
5FBE 1.43 Å, Complement factor D in complex with COMPOUND2
5FBI 1.47 Å, Complement factor D in complex with compound 3b
1BIO 1.5 Å, Human complement factor D in complex with isatoic anhydride inhibitor
6FUT 1.5 Å, Complement factor D in complex with the inhibitor (S)-3'-(aminomethyl)-N-(1,2,3,4-tetrahy…
5NAR 1.55 Å, Complement factor D in complex with the inhibitor (S)-pyrrolidine-1,2-dicarboxylic acid…

Browse structure collections

About this viewer

MolViewer shows 6FTY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.